SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48582-1|CAA88465.1|  490|Caenorhabditis elegans Hypothetical pr...    30   1.5  
Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical pr...    29   3.4  
AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical ...    28   7.8  

>Z48582-1|CAA88465.1|  490|Caenorhabditis elegans Hypothetical
           protein F27E5.3 protein.
          Length = 490

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 22/75 (29%), Positives = 32/75 (42%)
 Frame = -2

Query: 366 TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNEQ*K*WFFSDDRAKRSPTYATPL 187
           T+   S TS          +P    D  P PP   S++  K     DD  K++P Y   +
Sbjct: 317 TSNVPSGTSEASITNPILHSPPSKFDNIPSPPKAFSDDLRK---SPDDDVKQNPQYGMDI 373

Query: 186 MSPYNARLESSSTGS 142
           +SP    ++SS  GS
Sbjct: 374 VSPVQL-VKSSDKGS 387


>Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical protein
            F54B3.1b protein.
          Length = 3394

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -2

Query: 234  FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 115
            F DD  K     ++   S  +   ESSSTGSS  +D P+P
Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468


>Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical protein
            F54B3.1a protein.
          Length = 3396

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -2

Query: 234  FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 115
            F DD  K     ++   S  +   ESSSTGSS  +D P+P
Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468


>AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical
           protein Y53C10A.4 protein.
          Length = 908

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%)
 Frame = -2

Query: 231 SDDRAKRSPTYATP----LMSPYNARLESSSTGSSFPAD-SPKP 115
           +DD   R P + +     L  PY +   SSS+ SS P+D +P+P
Sbjct: 681 NDDSDSRFPAFKSSSVAMLTEPYKSSSSSSSSTSSIPSDPAPRP 724


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,284,119
Number of Sequences: 27780
Number of extensions: 378719
Number of successful extensions: 989
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 942
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 988
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1708383636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).