SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0090
         (604 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF040661-11|AAG24210.1|  211|Caenorhabditis elegans Hypothetical...    29   3.4  
AF040661-10|AAG24215.1|  426|Caenorhabditis elegans Hypothetical...    28   5.9  
Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical pr...    27   7.8  
Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical pr...    27   7.8  
Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical p...    27   7.8  
Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical p...    27   7.8  
Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical pr...    27   7.8  
Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical pr...    27   7.8  
Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical pr...    27   7.8  
Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical pr...    27   7.8  
AF040661-12|AAG24221.1|  210|Caenorhabditis elegans Hypothetical...    27   7.8  

>AF040661-11|AAG24210.1|  211|Caenorhabditis elegans Hypothetical
           protein W10G11.15 protein.
          Length = 211

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 14/55 (25%), Positives = 23/55 (41%)
 Frame = -2

Query: 297 RPSGRWCEATIRGISLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHS 133
           RPSG WC     G +   + AE S    G  +  ++ R      Q    ++++ S
Sbjct: 49  RPSGGWCMRVFEGFNAAKTDAEKSCKSVGSTLSGIQNRNEALYIQTALLAQIARS 103


>AF040661-10|AAG24215.1|  426|Caenorhabditis elegans Hypothetical
           protein W10G11.6 protein.
          Length = 426

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = -2

Query: 336 REEPQFRTFGSCTRPSGRWCEATIRGISLNASKAEASLAESGKDMLTVE-PRES 178
           R EP +R F    RPSG WC     G     + AEA+    G  +  ++ P+E+
Sbjct: 255 RCEPGWRFFN---RPSGGWCIRVFTGFHAAKADAEAACQAVGATLSGLQNPQEA 305



 Score = 27.5 bits (58), Expect = 7.8
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -2

Query: 297 RPSGRWCEATIRGISLNASKAEASLAESGKDMLTVEPRE 181
           RPSG WC     GI     +AE + A  G  +  ++ R+
Sbjct: 93  RPSGGWCMRVFTGIHDAKIEAERACAAKGGTLTGLQNRD 131


>Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical protein
            T12D8.1 protein.
          Length = 2561

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 20/96 (20%), Positives = 40/96 (41%)
 Frame = +2

Query: 29   ELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSIS 208
            ++Y DL+      ++   S++    N  R++      + R +       PD  G  + ++
Sbjct: 1147 QVYQDLKRVKFDRERLNGSLE-EQLNKARKQKKNLAAKKRQMVKTQTAAPDYDGRNIDLN 1205

Query: 209  LPDSARLASALEAFRLIPRMVASHHRPLGRVHEPNV 316
              D   LA+  E  ++    +  H R L + HE N+
Sbjct: 1206 ESDQQTLATLTEQIKVTQAEIELHRRDL-KKHESNL 1240


>Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical protein
            T12D8.1 protein.
          Length = 2561

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 20/96 (20%), Positives = 40/96 (41%)
 Frame = +2

Query: 29   ELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSIS 208
            ++Y DL+      ++   S++    N  R++      + R +       PD  G  + ++
Sbjct: 1147 QVYQDLKRVKFDRERLNGSLE-EQLNKARKQKKNLAAKKRQMVKTQTAAPDYDGRNIDLN 1205

Query: 209  LPDSARLASALEAFRLIPRMVASHHRPLGRVHEPNV 316
              D   LA+  E  ++    +  H R L + HE N+
Sbjct: 1206 ESDQQTLATLTEQIKVTQAEIELHRRDL-KKHESNL 1240


>Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical
            protein R11A8.7b protein.
          Length = 2584

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2255 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2295


>Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical
            protein R11A8.7a protein.
          Length = 2606

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2277 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2317


>Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical protein
            R11A8.7d protein.
          Length = 1427

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 1098 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 1138


>Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical protein
            R11A8.7c protein.
          Length = 1405

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 1076 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 1116


>Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical protein
            R11A8.7b protein.
          Length = 2584

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2255 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2295


>Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical protein
            R11A8.7a protein.
          Length = 2606

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = -1

Query: 556  VTTGITGL----WQPSVHSDLLFDPSMSALPIIAKQNSPSV 446
            VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2277 VTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2317


>AF040661-12|AAG24221.1|  210|Caenorhabditis elegans Hypothetical
           protein W10G11.14 protein.
          Length = 210

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 14/47 (29%), Positives = 21/47 (44%)
 Frame = -2

Query: 330 EPQFRTFGSCTRPSGRWCEATIRGISLNASKAEASLAESGKDMLTVE 190
           EP ++ F    RPSG WC     G +   + AE S    G  +  ++
Sbjct: 41  EPGWKFFN---RPSGGWCMRVFAGFNAKKADAEKSCQAVGSTLSGIQ 84


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,581,333
Number of Sequences: 27780
Number of extensions: 271173
Number of successful extensions: 816
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 796
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 816
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1289949676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).