SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81119-8|CAB03340.1|  504|Caenorhabditis elegans Hypothetical pr...    29   3.4  
AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical ...    28   6.0  
AC024843-6|AAF60844.3|  525|Caenorhabditis elegans Hypothetical ...    28   6.0  

>Z81119-8|CAB03340.1|  504|Caenorhabditis elegans Hypothetical
           protein T10H4.10 protein.
          Length = 504

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 64  DTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFN 204
           D    +L  R   G   +G   IF  VR    RF++ R D++  PFN
Sbjct: 200 DPEFEKLVSRLAKGFENTGFLDIFCPVRILESRFLKWRQDTIFEPFN 246


>AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical
           protein ZC190.4 protein.
          Length = 629

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = -3

Query: 695 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 561
           +GT+ +   DIID   +P N +S++ +  +++  R  ET++H+ +
Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328


>AC024843-6|AAF60844.3|  525|Caenorhabditis elegans Hypothetical
           protein Y61A9LA.3b protein.
          Length = 525

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +1

Query: 145 RSCRFRFVRDRHDSVRPPFNGQLRTGTDKGNPTV*LNKALRWPSRVLTQCDFCPVL 312
           ++ R +F +  H  + PP  G++R   D GN        + W  +V++  DF  +L
Sbjct: 411 QAARIQFFQSLHTLIPPPIFGKMRKCVDSGND-------MDWCMQVISSDDFREIL 459


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,787,248
Number of Sequences: 27780
Number of extensions: 352259
Number of successful extensions: 901
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 869
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 901
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1735436670
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).