SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL032631-9|CAA21575.2|  893|Caenorhabditis elegans Hypothetical ...    28   4.8  
AF099925-14|AAX55690.1|  679|Caenorhabditis elegans Calcium bind...    28   6.3  
AF038611-7|AAB92040.1|  466|Caenorhabditis elegans Hypothetical ...    28   6.3  
Z81588-2|CAB04712.1|  379|Caenorhabditis elegans Hypothetical pr...    27   8.4  
Z66494-3|CAA91258.2|  520|Caenorhabditis elegans Hypothetical pr...    27   8.4  

>AL032631-9|CAA21575.2|  893|Caenorhabditis elegans Hypothetical
           protein Y106G6H.7 protein.
          Length = 893

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = +2

Query: 383 ETATTSKEGSRRANYPLPAREVVTKNNDTGLLRGLVIGMSTLKYFNEEQLE 535
           E   T    +RR + PLPA    + +N+TGLL  ++  +++    ++ ++E
Sbjct: 3   ENGATPVAAARR-HRPLPAERATSNSNETGLLINVIRSLTSSVSEDQREVE 52


>AF099925-14|AAX55690.1|  679|Caenorhabditis elegans Calcium binding
           protein homologprotein 1, isoform d protein.
          Length = 679

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -3

Query: 411 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 307
           +P+  V+  ++ PS +S     + VTT  V+ TTI
Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593


>AF038611-7|AAB92040.1|  466|Caenorhabditis elegans Hypothetical
           protein E04A4.6 protein.
          Length = 466

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +2

Query: 47  DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 151
           D+  G++   WF +++SV WI +V+   I   +T+
Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258


>Z81588-2|CAB04712.1|  379|Caenorhabditis elegans Hypothetical
           protein T07D10.2 protein.
          Length = 379

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 428 GNLRACCLPWMW*PFLRLPLR 366
           GNL +C  PW+W  F R  L+
Sbjct: 330 GNLNSCMNPWLWFHFNRKQLK 350


>Z66494-3|CAA91258.2|  520|Caenorhabditis elegans Hypothetical
           protein C34C6.3 protein.
          Length = 520

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 89  SYSVTWITVVILELIHAIRTLTSDGMS 169
           SY+V+WIT       + IR + SDG++
Sbjct: 54  SYNVSWITPAASNSTYRIRLIDSDGLT 80


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,943,958
Number of Sequences: 27780
Number of extensions: 290002
Number of successful extensions: 750
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 709
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 750
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1385109898
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).