SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical p...    29   2.7  
Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical p...    29   2.7  
Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical pr...    29   2.7  
AF040661-10|AAG24215.1|  426|Caenorhabditis elegans Hypothetical...    28   4.6  
AF040661-11|AAG24210.1|  211|Caenorhabditis elegans Hypothetical...    27   8.1  

>Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical
            protein R11A8.7b protein.
          Length = 2584

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2251 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2295


>Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical
            protein R11A8.7a protein.
          Length = 2606

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2273 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2317


>Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical protein
            R11A8.7d protein.
          Length = 1427

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 1094 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 1138


>Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical protein
            R11A8.7c protein.
          Length = 1405

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 1072 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 1116


>Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical protein
            R11A8.7b protein.
          Length = 2584

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2251 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2295


>Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical protein
            R11A8.7a protein.
          Length = 2606

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
 Frame = -1

Query: 572  SARKVTTGITGL----WQPSVHSDVVFDPSMSALPIIAKQNSPSV 450
            S   VTTG++ L    W P+  +    DP+ S  P+ A+  S SV
Sbjct: 2273 STSSVTTGLSSLELKGWMPASFAPSARDPNRSQPPLFARSQSNSV 2317


>AF040661-10|AAG24215.1|  426|Caenorhabditis elegans Hypothetical
           protein W10G11.6 protein.
          Length = 426

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -2

Query: 301 RPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRE 185
           RPSG WC     GI     +AE + A  G  +  ++ R+
Sbjct: 93  RPSGGWCMRVFTGIHDAKIEAERACAAKGGTLTGLQNRD 131



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = -2

Query: 340 REEPQFRTFGSCTRPSGRWCEATIRGIMPNASKAEASLA 224
           R EP +R F    RPSG WC     G   +A+KA+A  A
Sbjct: 255 RCEPGWRFFN---RPSGGWCIRVFTGF--HAAKADAEAA 288


>AF040661-11|AAG24210.1|  211|Caenorhabditis elegans Hypothetical
           protein W10G11.15 protein.
          Length = 211

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 14/55 (25%), Positives = 22/55 (40%)
 Frame = -2

Query: 301 RPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHS 137
           RPSG WC     G     + AE S    G  +  ++ R      Q    ++++ S
Sbjct: 49  RPSGGWCMRVFEGFNAAKTDAEKSCKSVGSTLSGIQNRNEALYIQTALLAQIARS 103


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,485,741
Number of Sequences: 27780
Number of extensions: 297316
Number of successful extensions: 871
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 871
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1342816466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).