SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z37139-5|CAA85490.1|  558|Caenorhabditis elegans Hypothetical pr...    29   3.7  
U80453-9|AAT81206.1|  432|Caenorhabditis elegans Hypothetical pr...    28   4.8  
AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical ...    28   4.8  
U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical pr...    27   8.4  

>Z37139-5|CAA85490.1|  558|Caenorhabditis elegans Hypothetical
           protein C14B1.9 protein.
          Length = 558

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 20/98 (20%), Positives = 43/98 (43%), Gaps = 2/98 (2%)
 Frame = -2

Query: 606 PREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNRI-TREF*TATSVSATSPLCTLGTK 430
           P+++S+    ++G    +  ++P Q NSP  +V N   T +   A S + ++       K
Sbjct: 252 PKKISLDKPKSVGSPSNAHNEIPSQKNSPKSAVKNETDTEDALMAKSGNLSTAAVMFKNK 311

Query: 429 -HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 319
            H      +D    P N    ET+  ++ +   ++ ++
Sbjct: 312 VHTLQCQFLDSHGNPQNTPDFETLSKILSEHFDKKELT 349


>U80453-9|AAT81206.1|  432|Caenorhabditis elegans Hypothetical
           protein C23H3.9d protein.
          Length = 432

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = -2

Query: 549 TDVPPQSNSPHGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPP-NRVS 373
           T   P+S+S     + R+   + T T  +A S      T  +AP  I DR   P  NR+S
Sbjct: 69  TTSEPRSHSRDARPTQRLPLTWSTVTPTAAPSQPIPTATSRKAPWYIKDRTAWPTYNRIS 128

Query: 372 NE 367
            E
Sbjct: 129 AE 130


>AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical
           protein ZC190.4 protein.
          Length = 629

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = -2

Query: 441 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 307
           +GT+ +   DIID   +P N +S++ +  +++  R  ET++H+ +
Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328


>U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical protein
            C13F10.4 protein.
          Length = 2076

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 501  GSRHCHAGSLTGAVHLSKNNAGVLRPAQRGQKPRVE 608
            G  H H GSL    HL+   + VL  A+  + P+V+
Sbjct: 937  GCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQ 972


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,223,350
Number of Sequences: 27780
Number of extensions: 284291
Number of successful extensions: 695
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 679
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 695
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1395683256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).