SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like ...    30   1.5  
AC024847-10|AAF60859.1|  393|Caenorhabditis elegans Ground-like ...    30   1.5  
AY157938-1|AAN35200.1| 1751|Caenorhabditis elegans ANC-1 protein.      29   3.4  
AF045643-5|AAC02592.1|  607|Caenorhabditis elegans Hypothetical ...    29   3.4  
AC006834-1|AAF40010.3| 8545|Caenorhabditis elegans Abnormal nucl...    29   3.4  
U00040-1|AAA50664.3| 1770|Caenorhabditis elegans Hypothetical pr...    28   5.9  
AF099925-14|AAX55690.1|  679|Caenorhabditis elegans Calcium bind...    28   5.9  
AF038611-7|AAB92040.1|  466|Caenorhabditis elegans Hypothetical ...    28   5.9  
Z81588-2|CAB04712.1|  379|Caenorhabditis elegans Hypothetical pr...    27   7.9  
Z66494-3|CAA91258.2|  520|Caenorhabditis elegans Hypothetical pr...    27   7.9  

>AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like
           (grd related) protein16, isoform b protein.
          Length = 453

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +1

Query: 439 GSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTPV 579
           G++   PGP+G G  A S + ++ GP +  ASQ    S    S+ P+
Sbjct: 108 GAYQAGPGPIGGG--ASSHAGSQAGPSYAGASQAVGASSYARSQGPI 152


>AC024847-10|AAF60859.1|  393|Caenorhabditis elegans Ground-like
           (grd related) protein16, isoform a protein.
          Length = 393

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +1

Query: 439 GSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTPV 579
           G++   PGP+G G  A S + ++ GP +  ASQ    S    S+ P+
Sbjct: 108 GAYQAGPGPIGGG--ASSHAGSQAGPSYAGASQAVGASSYARSQGPI 152


>AY157938-1|AAN35200.1| 1751|Caenorhabditis elegans ANC-1 protein.
          Length = 1751

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 16/55 (29%), Positives = 23/55 (41%)
 Frame = +1

Query: 328 WLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADS 492
           W    TG +      +PE  +  P     ++ +HS+  S SG    L  GE A S
Sbjct: 141 WGWAATGTEEPTSSAQPEVVVTAPSPTPSSKKSHSKVSSLSGSKTSLASGEKAPS 195


>AF045643-5|AAC02592.1|  607|Caenorhabditis elegans Hypothetical
           protein F58H7.1 protein.
          Length = 607

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 13/37 (35%), Positives = 17/37 (45%)
 Frame = +1

Query: 376 PEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHA 486
           P ++LPH +  A  Q        F GL GP+ Q   A
Sbjct: 233 PNRQLPHEQSDANGQAQSHGPFGFHGLQGPISQNVQA 269


>AC006834-1|AAF40010.3| 8545|Caenorhabditis elegans Abnormal nuclear
           anchorage protein1 protein.
          Length = 8545

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 16/55 (29%), Positives = 23/55 (41%)
 Frame = +1

Query: 328 WLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADS 492
           W    TG +      +PE  +  P     ++ +HS+  S SG    L  GE A S
Sbjct: 141 WGWAATGTEEPTSSAQPEVVVTAPSPTPSSKKSHSKVSSLSGSKTSLASGEKAPS 195


>U00040-1|AAA50664.3| 1770|Caenorhabditis elegans Hypothetical protein
            C18H2.1 protein.
          Length = 1770

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 2/53 (3%)
 Frame = +3

Query: 381  ETATTSKEGSRRANYPLPAREF--QRVARASRPGRTC*FLQCSARRPRTSKGI 533
            ET T  +E S   N PL   +        ASRP R     QC  R+ +++K I
Sbjct: 1504 ETRTFLREPSTHRNAPLQTTQVTAHHAGNASRPRRQPKSTQCVPRKRKSAKSI 1556


>AF099925-14|AAX55690.1|  679|Caenorhabditis elegans Calcium binding
           protein homologprotein 1, isoform d protein.
          Length = 679

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -2

Query: 409 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 305
           +P+  V+  ++ PS +S     + VTT  V+ TTI
Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593


>AF038611-7|AAB92040.1|  466|Caenorhabditis elegans Hypothetical
           protein E04A4.6 protein.
          Length = 466

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +3

Query: 45  DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 149
           D+  G++   WF +++SV WI +V+   I   +T+
Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258


>Z81588-2|CAB04712.1|  379|Caenorhabditis elegans Hypothetical
           protein T07D10.2 protein.
          Length = 379

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 426 GNLRACCLPWMW*PFLRLPLR 364
           GNL +C  PW+W  F R  L+
Sbjct: 330 GNLNSCMNPWLWFHFNRKQLK 350


>Z66494-3|CAA91258.2|  520|Caenorhabditis elegans Hypothetical
           protein C34C6.3 protein.
          Length = 520

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 87  SYSVTWITVVILELIHAIRTLTSDGMS 167
           SY+V+WIT       + IR + SDG++
Sbjct: 54  SYNVSWITPAASNSTYRIRLIDSDGLT 80


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,833,935
Number of Sequences: 27780
Number of extensions: 300408
Number of successful extensions: 959
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 959
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1300523034
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).