SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF303255-1|AAG50213.1|  573|Caenorhabditis elegans putative guan...   146   9e-36
AC024817-8|AAU05551.1|  535|Caenorhabditis elegans Hypothetical ...   146   9e-36
AC024817-7|AAK68527.1|  573|Caenorhabditis elegans Hypothetical ...   146   9e-36
Z95559-2|CAB09000.3|  520|Caenorhabditis elegans Hypothetical pr...   106   1e-23
AL132876-20|CAD92404.1| 1127|Caenorhabditis elegans Hypothetical...    30   1.6  
AL132876-19|CAD21673.1| 1161|Caenorhabditis elegans Hypothetical...    30   1.6  
AF332207-1|AAK17978.1|  378|Caenorhabditis elegans nuclear recep...    28   4.9  
AF016445-12|AAC69062.1|  374|Caenorhabditis elegans Nuclear horm...    28   4.9  
U64845-6|AAC48028.1|  556|Caenorhabditis elegans Hypothetical pr...    27   8.5  

>AF303255-1|AAG50213.1|  573|Caenorhabditis elegans putative
           guanylate-binding protein protein.
          Length = 573

 Score =  146 bits (355), Expect = 9e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSERDT GIL+WSE F     +GE++A++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 117 PLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFA 176

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SSVQIYNLSQNIQEDDLQHL
Sbjct: 177 LSTMISSVQIYNLSQNIQEDDLQHL 201



 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/84 (70%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLALED    PFQ L FLVRDWSFPYEA +G  GG ++L RRL+VS+KQH ELQ
Sbjct: 203 LFTEYGRLALEDSASKPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQ 262

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
            LR+HI +CF ++ CFLMPHPGLK
Sbjct: 263 QLRQHIRSCFEDIRCFLMPHPGLK 286



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           VI VAGA+RKGKSFLL+FFLRY+ ++
Sbjct: 69  VIGVAGAYRKGKSFLLNFFLRYLTWR 94


>AC024817-8|AAU05551.1|  535|Caenorhabditis elegans Hypothetical
           protein Y54G2A.2b protein.
          Length = 535

 Score =  146 bits (355), Expect = 9e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSERDT GIL+WSE F     +GE++A++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 117 PLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFA 176

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SSVQIYNLSQNIQEDDLQHL
Sbjct: 177 LSTMISSVQIYNLSQNIQEDDLQHL 201



 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/84 (70%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLALED    PFQ L FLVRDWSFPYEA +G  GG ++L RRL+VS+KQH ELQ
Sbjct: 203 LFTEYGRLALEDSASKPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQ 262

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
            LR+HI +CF ++ CFLMPHPGLK
Sbjct: 263 QLRQHIRSCFEDIRCFLMPHPGLK 286



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           VI VAGA+RKGKSFLL+FFLRY+ ++
Sbjct: 69  VIGVAGAYRKGKSFLLNFFLRYLTWR 94


>AC024817-7|AAK68527.1|  573|Caenorhabditis elegans Hypothetical
           protein Y54G2A.2a protein.
          Length = 573

 Score =  146 bits (355), Expect = 9e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSERDT GIL+WSE F     +GE++A++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 117 PLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFA 176

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SSVQIYNLSQNIQEDDLQHL
Sbjct: 177 LSTMISSVQIYNLSQNIQEDDLQHL 201



 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/84 (70%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLALED    PFQ L FLVRDWSFPYEA +G  GG ++L RRL+VS+KQH ELQ
Sbjct: 203 LFTEYGRLALEDSASKPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQ 262

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
            LR+HI +CF ++ CFLMPHPGLK
Sbjct: 263 QLRQHIRSCFEDIRCFLMPHPGLK 286



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           VI VAGA+RKGKSFLL+FFLRY+ ++
Sbjct: 69  VIGVAGAYRKGKSFLLNFFLRYLTWR 94


>Z95559-2|CAB09000.3|  520|Caenorhabditis elegans Hypothetical
           protein Y41E3.3 protein.
          Length = 520

 Score =  106 bits (255), Expect = 1e-23
 Identities = 49/84 (58%), Positives = 59/84 (70%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           L GF WR G +RDT GI +W E        GE  A++L+DTQG FD+ ST + C TVFAL
Sbjct: 110 LHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFAL 169

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           ST++SSVQIYN+  NIQED LQHL
Sbjct: 170 STIVSSVQIYNVVDNIQEDALQHL 193



 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 2/87 (2%)
 Frame = -3

Query: 256 SLFTEYGRLALEDGGR--TPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHP 83
           SLF EYGR+A+E       PFQ+L F VRD+    E  +G +GG   L   L+ + +Q  
Sbjct: 194 SLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPE 253

Query: 82  ELQSLRKHITACFSELACFLMPHPGLK 2
           E++ +R+ +   F ++ C+L+PHPG K
Sbjct: 254 EIKQVRELLREYFEDIQCYLLPHPGYK 280



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           +ISVAGAFRKGKSFLL+FFL Y++
Sbjct: 66  IISVAGAFRKGKSFLLNFFLEYLY 89


>AL132876-20|CAD92404.1| 1127|Caenorhabditis elegans Hypothetical
            protein Y105E8A.24b protein.
          Length = 1127

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -2

Query: 227  ARGRGPDSLPAAAVPRARLELPLRSALRSGRRHADTVKKIKGIRQ 93
            ARGRG   L          +LP+R  +R+ R   + +K++  +R+
Sbjct: 960  ARGRGDSELDRKTYGEMLSDLPIRQTMRARRASTNLIKEVISLRK 1004


>AL132876-19|CAD21673.1| 1161|Caenorhabditis elegans Hypothetical
            protein Y105E8A.24a protein.
          Length = 1161

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -2

Query: 227  ARGRGPDSLPAAAVPRARLELPLRSALRSGRRHADTVKKIKGIRQ 93
            ARGRG   L          +LP+R  +R+ R   + +K++  +R+
Sbjct: 960  ARGRGDSELDRKTYGEMLSDLPIRQTMRARRASTNLIKEVISLRK 1004


>AF332207-1|AAK17978.1|  378|Caenorhabditis elegans nuclear receptor
           NHR-57 protein.
          Length = 378

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +3

Query: 294 GCISERTTASWTERTRSRSLAPWIHCRRRLACLAILS 404
           G I+ +  A++  RT S +LAP   CR++  C+  +S
Sbjct: 27  GAIACKACAAFFRRTTSMNLAPKFVCRKKNECVIKMS 63


>AF016445-12|AAC69062.1|  374|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 57 protein.
          Length = 374

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +3

Query: 294 GCISERTTASWTERTRSRSLAPWIHCRRRLACLAILS 404
           G I+ +  A++  RT S +LAP   CR++  C+  +S
Sbjct: 23  GAIACKACAAFFRRTTSMNLAPKFVCRKKNECVIKMS 59


>U64845-6|AAC48028.1|  556|Caenorhabditis elegans Hypothetical
           protein F45F2.5 protein.
          Length = 556

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 338 TVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLS 478
           T  Q   + S SK     SNIIA F    SVA+N+ + +S+ ++  S
Sbjct: 173 TFMQMHFIFSNSKISLKRSNIIAKFGLMHSVAVNLWNWLSICLIKSS 219


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,479,357
Number of Sequences: 27780
Number of extensions: 261593
Number of successful extensions: 810
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 758
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 809
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1406256614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).