SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z37139-5|CAA85490.1|  558|Caenorhabditis elegans Hypothetical pr...    30   1.3  
AC006712-8|AAU20838.1|  450|Caenorhabditis elegans Hypothetical ...    30   1.3  
Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical pr...    29   4.0  
AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical ...    28   5.3  
AF101319-6|AAC69351.1|  314|Caenorhabditis elegans Hypothetical ...    28   6.9  
Z93377-5|CAB07579.1|  195|Caenorhabditis elegans Hypothetical pr...    27   9.2  

>Z37139-5|CAA85490.1|  558|Caenorhabditis elegans Hypothetical
           protein C14B1.9 protein.
          Length = 558

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 21/98 (21%), Positives = 44/98 (44%), Gaps = 2/98 (2%)
 Frame = -2

Query: 618 PREVSVLSELALGHLRYSLTDVPPQSNSPPGSVL-EPDTREF*TATSVSATSPLCTLGTK 442
           P+++S+    ++G    +  ++P Q NSP  +V  E DT +   A S + ++       K
Sbjct: 252 PKKISLDKPKSVGSPSNAHNEIPSQKNSPKSAVKNETDTEDALMAKSGNLSTAAVMFKNK 311

Query: 441 -HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 331
            H      +D    P N    ET+  ++ +   ++ ++
Sbjct: 312 VHTLQCQFLDSHGNPQNTPDFETLSKILSEHFDKKELT 349


>AC006712-8|AAU20838.1|  450|Caenorhabditis elegans Hypothetical
           protein Y119C1B.3 protein.
          Length = 450

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -3

Query: 548 PSQTPRLAVSSNRTRGSFKRRRAFPPRHHSARLER 444
           P++TP+   SS     S +R + FP  HH  RL+R
Sbjct: 409 PTRTPKQRRSSRIRSISDEREQLFPRHHHGRRLDR 443


>Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical
           protein F28D9.1 protein.
          Length = 601

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 474 RKRSSPFKTPACPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKPRVEQRAK 632
           R+R SP K+P  P R    +GS + +    ++ A   R  Q  Q+ R  +R +
Sbjct: 452 RRRRSPSKSPQAPRRRRSPSGSKSRSPRRRRSPAAAPRRRQSPQRRRSPRRRR 504


>AF078788-1|AAC26965.2|  629|Caenorhabditis elegans Hypothetical
           protein ZC190.4 protein.
          Length = 629

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = -2

Query: 453 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 319
           +GT+ +   DIID   +P N +S++ +  +++  R  ET++H+ +
Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328


>AF101319-6|AAC69351.1|  314|Caenorhabditis elegans Hypothetical
           protein K08D9.1 protein.
          Length = 314

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = -3

Query: 332 PTYATPLMSPYNARLXSSSTGSSFPAI-LPSPFPWLWFR*IV 210
           P   TPL+SPY     S  TG  +P I +  PF  L F  IV
Sbjct: 74  PILVTPLLSPYIQENISLQTGWLYPFIGIYPPFDALSFMWIV 115


>Z93377-5|CAB07579.1|  195|Caenorhabditis elegans Hypothetical
           protein F13A7.9 protein.
          Length = 195

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 13/54 (24%), Positives = 26/54 (48%)
 Frame = -2

Query: 522 VLEPDTREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 361
           ++  D +EF  +   +  S +       RAP D    AP+P  +V+ + + +V+
Sbjct: 25  LVSEDKQEFTISAKAAKKSIVLNDVISRRAPEDSAPMAPIPVEKVTGDILNMVI 78


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,313,616
Number of Sequences: 27780
Number of extensions: 354564
Number of successful extensions: 981
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 898
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 980
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1518563232
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).