SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF353303-1|AAK32717.1|  367|Caenorhabditis elegans GATA-like tra...    30   0.67 
AF100657-1|AAC68957.3|  367|Caenorhabditis elegans Erythroid-lik...    30   0.67 
AC006708-26|AAF60419.1| 1724|Caenorhabditis elegans Holocentric ...    29   1.2  
AC006708-25|AAK68883.1| 1758|Caenorhabditis elegans Holocentric ...    29   1.2  
AC024817-40|AAF59577.4|  967|Caenorhabditis elegans Hypothetical...    27   3.6  
AC024794-1|AAK68497.1|  994|Caenorhabditis elegans Hypothetical ...    27   3.6  
AF047662-7|AAC04439.1|  955|Caenorhabditis elegans Hypothetical ...    27   4.7  
U88167-2|AAB42225.3|  908|Caenorhabditis elegans Hypothetical pr...    27   6.2  
Z92973-7|CAB07494.1| 1213|Caenorhabditis elegans Hypothetical pr...    26   8.2  
Z81481-10|CAB03951.1| 1213|Caenorhabditis elegans Hypothetical p...    26   8.2  
AC024817-16|AAF59585.2|  610|Caenorhabditis elegans Hypothetical...    26   8.2  

>AF353303-1|AAK32717.1|  367|Caenorhabditis elegans GATA-like
           transcription factorELT-6 protein.
          Length = 367

 Score = 29.9 bits (64), Expect = 0.67
 Identities = 15/57 (26%), Positives = 32/57 (56%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQS 283
           G++  L+ + ++  +EQM E    +   PS  +++ +P S GKS+   R+ +  ++S
Sbjct: 61  GRLEALISEKEKVLLEQMSESGSEEKYPPSPTESRASPSSVGKSNGGCRKRKPTKES 117


>AF100657-1|AAC68957.3|  367|Caenorhabditis elegans Erythroid-like
           transcription factorfamily protein 6 protein.
          Length = 367

 Score = 29.9 bits (64), Expect = 0.67
 Identities = 15/57 (26%), Positives = 32/57 (56%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQS 283
           G++  L+ + ++  +EQM E    +   PS  +++ +P S GKS+   R+ +  ++S
Sbjct: 61  GRLEALISEKEKVLLEQMSESGSEEKYPPSPTESRASPSSVGKSNGGCRKRKPTKES 117


>AC006708-26|AAF60419.1| 1724|Caenorhabditis elegans Holocentric
            chromosome bindingprotein protein 6, isoform a protein.
          Length = 1724

 Score = 29.1 bits (62), Expect = 1.2
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +2

Query: 26   ISEFLTKSRHDVFLEARSHFGVKR-CWTTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPS 202
            + EFL + R    L+ +    ++  C      I  +L DN++ K E MFELQ +K +   
Sbjct: 1303 LREFLNQHRSP--LQRKCLLAIRMICIEHKNDIDEILQDNRQLKDEMMFELQRVKQRTEE 1360

Query: 203  AQK 211
            A +
Sbjct: 1361 ANR 1363


>AC006708-25|AAK68883.1| 1758|Caenorhabditis elegans Holocentric
            chromosome bindingprotein protein 6, isoform b protein.
          Length = 1758

 Score = 29.1 bits (62), Expect = 1.2
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +2

Query: 26   ISEFLTKSRHDVFLEARSHFGVKR-CWTTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPS 202
            + EFL + R    L+ +    ++  C      I  +L DN++ K E MFELQ +K +   
Sbjct: 1303 LREFLNQHRSP--LQRKCLLAIRMICIEHKNDIDEILQDNRQLKDEMMFELQRVKQRTEE 1360

Query: 203  AQK 211
            A +
Sbjct: 1361 ANR 1363


>AC024817-40|AAF59577.4|  967|Caenorhabditis elegans Hypothetical
           protein Y54G2A.21 protein.
          Length = 967

 Score = 27.5 bits (58), Expect = 3.6
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 2/57 (3%)
 Frame = -2

Query: 187 FQMLKFKHL-FNLTAFIIREKDDYF-PICCPAALNAEMRAGLQKDIMT*FGQKF*ND 23
           FQ     HL   LT  ++ E  + F P  CP  L  +   G    IM+  G KF ND
Sbjct: 683 FQSFCGNHLKLLLTPAVVEETFNIFGPNLCPMLLGLKSAMGKLSTIMSLSGNKFLND 739


>AC024794-1|AAK68497.1|  994|Caenorhabditis elegans Hypothetical
           protein Y48G1BM.5 protein.
          Length = 994

 Score = 27.5 bits (58), Expect = 3.6
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 2/57 (3%)
 Frame = -2

Query: 187 FQMLKFKHL-FNLTAFIIREKDDYF-PICCPAALNAEMRAGLQKDIMT*FGQKF*ND 23
           FQ     HL   LT  ++ E  + F P  CP  L  +   G    IM+  G KF ND
Sbjct: 159 FQSFCGNHLKLLLTPAVVEETFNIFGPNLCPMLLGLKSAMGKLSTIMSLSGNKFLND 215


>AF047662-7|AAC04439.1|  955|Caenorhabditis elegans Hypothetical
           protein T22B2.1 protein.
          Length = 955

 Score = 27.1 bits (57), Expect = 4.7
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +2

Query: 155 IEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVESS 319
           IEQ  E+ HLK +  S Q      + S KS  E  +   +++S  +   RL+E +
Sbjct: 716 IEQKDEILHLKAQNQSQQTVIAQQEKSIKSLKEKSQQLEEKRSITNNTQRLLEET 770


>U88167-2|AAB42225.3|  908|Caenorhabditis elegans Hypothetical
           protein D2092.5 protein.
          Length = 908

 Score = 26.6 bits (56), Expect = 6.2
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 200 SAQKAQGAPQSSGKSHDEPRRHQNQRQ 280
           ++QK Q   QS+GKSH +   HQN  Q
Sbjct: 468 NSQKQQ--KQSNGKSHHQHSSHQNNHQ 492


>Z92973-7|CAB07494.1| 1213|Caenorhabditis elegans Hypothetical
           protein C38D9.5 protein.
          Length = 1213

 Score = 26.2 bits (55), Expect = 8.2
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +3

Query: 84  SALSAAGQQMGK*SSFSRIINAVRLNRCLNFSI*KPS 194
           SA SA  Q +   SS SR++NA+ L + L     KP+
Sbjct: 31  SAYSALQQTVENFSSLSRLVNAISLQQALLDGSAKPN 67


>Z81481-10|CAB03951.1| 1213|Caenorhabditis elegans Hypothetical
           protein C38D9.5 protein.
          Length = 1213

 Score = 26.2 bits (55), Expect = 8.2
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +3

Query: 84  SALSAAGQQMGK*SSFSRIINAVRLNRCLNFSI*KPS 194
           SA SA  Q +   SS SR++NA+ L + L     KP+
Sbjct: 31  SAYSALQQTVENFSSLSRLVNAISLQQALLDGSAKPN 67


>AC024817-16|AAF59585.2|  610|Caenorhabditis elegans Hypothetical
           protein Y54G2A.13 protein.
          Length = 610

 Score = 26.2 bits (55), Expect = 8.2
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = +2

Query: 191 KFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVESSMAVS*T 337
           K P+A K Q AP+   K  +     + + Q++K       E S A S T
Sbjct: 401 KKPAAPKTQAAPKPGAKLRETQAAQKKEVQTKKKYPSEKSEKSEATSPT 449


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,578,279
Number of Sequences: 27780
Number of extensions: 164639
Number of successful extensions: 528
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 528
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 587646290
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).