SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U88310-3|AAB42337.1|  608|Caenorhabditis elegans Hypothetical pr...    29   3.3  
U41104-5|AAK18976.3| 1564|Caenorhabditis elegans Twik family of ...    29   4.4  
Z93396-5|CAB07714.1|  633|Caenorhabditis elegans Hypothetical pr...    28   5.8  
DQ645956-1|ABG36764.1|  624|Caenorhabditis elegans molting prote...    28   5.8  

>U88310-3|AAB42337.1|  608|Caenorhabditis elegans Hypothetical
           protein C24G7.1 protein.
          Length = 608

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +1

Query: 469 NMISVLFCWFSELQVMINRDNW 534
           NMI+ +  WF+E+ ++I   NW
Sbjct: 161 NMINYIMHWFTEVPILIGSSNW 182


>U41104-5|AAK18976.3| 1564|Caenorhabditis elegans Twik family of
           potassium channelsprotein 2 protein.
          Length = 1564

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 2/53 (3%)
 Frame = -2

Query: 590 CSSCDDPRISP--LTSQYECPQLSLLIITWSSENQQNRTEIIFYYSMHEIFKQ 438
           C   DD    P  L S YECP++    +  S   Q +    ++Y     +F Q
Sbjct: 763 CDEDDDRECIPHILLSDYECPEMFTSSVISSPRRQLHSAPRVYYQPRPSLFSQ 815


>Z93396-5|CAB07714.1|  633|Caenorhabditis elegans Hypothetical
           protein ZC15.7 protein.
          Length = 633

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)
 Frame = -1

Query: 552 VAIRMPPVIPINHYLEF*KP---TK*NRDHILLFH----ARNIQAAFL 430
           V + +P  IP+  +LE  KP   T+ NRD +   H    ARN++A  L
Sbjct: 220 VGVNLPQAIPVIRFLEKKKPVSKTRQNRDGMTALHIAVAARNLEAVQL 267


>DQ645956-1|ABG36764.1|  624|Caenorhabditis elegans molting protein
           MLT-4 protein.
          Length = 624

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)
 Frame = -1

Query: 552 VAIRMPPVIPINHYLEF*KP---TK*NRDHILLFH----ARNIQAAFL 430
           V + +P  IP+  +LE  KP   T+ NRD +   H    ARN++A  L
Sbjct: 220 VGVNLPQAIPVIRFLEKKKPVSKTRQNRDGMTALHIAVAARNLEAVQL 267


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,100,314
Number of Sequences: 27780
Number of extensions: 332859
Number of successful extensions: 680
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 680
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).