SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and en...    57   2e-08
L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RET...    57   2e-08
L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RET...    57   2e-08
U50312-11|AAK71353.2| 1217|Caenorhabditis elegans Hypothetical p...    29   3.1  
U41625-5|AAA83327.1|  700|Caenorhabditis elegans Suppressor of a...    29   3.1  
AY091467-1|AAM44123.1|  700|Caenorhabditis elegans SUR-5 protein.      29   3.1  
AF045646-8|AAK29830.1|  541|Caenorhabditis elegans Udp-glucurono...    29   3.1  
AF038614-1|AAB92058.2| 1228|Caenorhabditis elegans Hypothetical ...    29   4.0  
AF022973-11|AAK84524.3|  560|Caenorhabditis elegans Hypothetical...    29   4.0  
U41007-17|AAA82261.1|  507|Caenorhabditis elegans Hypothetical p...    29   5.3  
U88173-6|AAM15575.1| 1282|Caenorhabditis elegans Hypothetical pr...    28   7.1  
U88173-5|AAM15574.1| 1280|Caenorhabditis elegans Hypothetical pr...    28   7.1  
Z54307-6|CAA91093.1|   77|Caenorhabditis elegans Hypothetical pr...    28   9.3  
AC024791-30|AAL32250.2| 2460|Caenorhabditis elegans Hypothetical...    28   9.3  

>U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and env
            protein precursor protein.
          Length = 2272

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 29/94 (30%), Positives = 49/94 (52%)
 Frame = -1

Query: 820  IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
            IP  ++TDQG  F + +  Q   +  I+HI    Y+ +  GA+ER + T+   ++     
Sbjct: 1680 IPLKLLTDQGKEFVNGLFAQFTHMLKIEHITTKGYNSRANGAVERFNKTIMHIMKKKTAV 1739

Query: 640  NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                WD  +  A+ AYN+ +H  TG +P+ L+ G
Sbjct: 1740 PME-WDDQVVYAVYAYNNCVHENTGETPMFLMHG 1772


>L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RETR-1
            protein, isoforma protein.
          Length = 2175

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 29/94 (30%), Positives = 49/94 (52%)
 Frame = -1

Query: 820  IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
            IP  ++TDQG  F + +  Q   +  I+HI    Y+ +  GA+ER + T+   ++     
Sbjct: 1583 IPLKLLTDQGKEFVNGLFAQFTHMLKIEHITTKGYNSRANGAVERFNKTIMHIMKKKTAV 1642

Query: 640  NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                WD  +  A+ AYN+ +H  TG +P+ L+ G
Sbjct: 1643 PME-WDDQVVYAVYAYNNCVHENTGETPMFLMHG 1675


>L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RETR-1
            protein, isoformb protein.
          Length = 2186

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 29/94 (30%), Positives = 49/94 (52%)
 Frame = -1

Query: 820  IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
            IP  ++TDQG  F + +  Q   +  I+HI    Y+ +  GA+ER + T+   ++     
Sbjct: 1594 IPLKLLTDQGKEFVNGLFAQFTHMLKIEHITTKGYNSRANGAVERFNKTIMHIMKKKTAV 1653

Query: 640  NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                WD  +  A+ AYN+ +H  TG +P+ L+ G
Sbjct: 1654 PME-WDDQVVYAVYAYNNCVHENTGETPMFLMHG 1686


>U50312-11|AAK71353.2| 1217|Caenorhabditis elegans Hypothetical
           protein B0222.9 protein.
          Length = 1217

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +1

Query: 208 FGGLSMNGSWIFCMCEVYPGGVCNPSF 288
           FGG   N SWI CMC +    +  P++
Sbjct: 708 FGGKVNNASWIACMCAIVAKKLNRPTY 734


>U41625-5|AAA83327.1|  700|Caenorhabditis elegans Suppressor of
           activated let-60ras protein 5 protein.
          Length = 700

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = -3

Query: 254 SHIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAKERSDFVACPRLAFDCYKI 96
           SH+QK+Q P   KPP+   T  L+ R+       K+ +D+    R   D Y I
Sbjct: 38  SHVQKLQ-PVYYKPPQNLETFELSLRNHFEEKTNKKFADYREFHRFTCDNYGI 89


>AY091467-1|AAM44123.1|  700|Caenorhabditis elegans SUR-5 protein.
          Length = 700

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = -3

Query: 254 SHIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAKERSDFVACPRLAFDCYKI 96
           SH+QK+Q P   KPP+   T  L+ R+       K+ +D+    R   D Y I
Sbjct: 38  SHVQKLQ-PVYYKPPQNLETFELSLRNHFEEKTNKKFADYREFHRFTCDNYGI 89


>AF045646-8|AAK29830.1|  541|Caenorhabditis elegans
           Udp-glucuronosyltransferase protein52 protein.
          Length = 541

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)
 Frame = -1

Query: 694 LERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST-TGFSPLELLFGFKPYIPK 518
           L +SH    + L   +VEN HT DL +       NS++ S  T     +  +GF+   P 
Sbjct: 41  LGKSHIDFTDSLIESLVENGHTVDLII----ARMNSHVKSNGTNMVTRKYTYGFQEESPW 96

Query: 517 SIDSLDLNTYSDYIRALNHRLYY 449
           +     LN +    R  N   YY
Sbjct: 97  NKAPHLLNPFKGRERTWNEHTYY 119


>AF038614-1|AAB92058.2| 1228|Caenorhabditis elegans Hypothetical
           protein F15E6.6 protein.
          Length = 1228

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 208 FGGLSMNGSWIFCMCEVYPGGVCNPSFCV 294
           FGG   N SWI C+C V    +  P++ V
Sbjct: 740 FGGKLNNASWIACICSVVAKKLNRPTYGV 768


>AF022973-11|AAK84524.3|  560|Caenorhabditis elegans Hypothetical
           protein F25G6.1 protein.
          Length = 560

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 2/31 (6%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--EVMKQLERLFGIK 737
           G+P  II + G+N ++  E +K+LERL+G +
Sbjct: 174 GVPDAIIGNSGSNAATTLETIKELERLYGTR 204


>U41007-17|AAA82261.1|  507|Caenorhabditis elegans Hypothetical
           protein C33H5.2 protein.
          Length = 507

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%)
 Frame = +3

Query: 582 ILELYASIAVLRYKSHV---CWFSTIYDLRYSFRVE*LLSRAPQVC 710
           I +L+A +  +RY S +   C+    YD  YS R E +    PQ C
Sbjct: 417 IKKLFAELPKIRYYSDLVLKCYNEKFYDYFYSGRYEKITCPGPQYC 462


>U88173-6|AAM15575.1| 1282|Caenorhabditis elegans Hypothetical
           protein F46F11.9b protein.
          Length = 1282

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 173 STHPTVAKERSDFVACPRLAFDCYKIVSARF 81
           S H  +A  R    A P L+FDCY++    F
Sbjct: 516 SFHRVLAANRFSNAAIPALSFDCYRLALPAF 546


>U88173-5|AAM15574.1| 1280|Caenorhabditis elegans Hypothetical
           protein F46F11.9a protein.
          Length = 1280

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 173 STHPTVAKERSDFVACPRLAFDCYKIVSARF 81
           S H  +A  R    A P L+FDCY++    F
Sbjct: 514 SFHRVLAANRFSNAAIPALSFDCYRLALPAF 544


>Z54307-6|CAA91093.1|   77|Caenorhabditis elegans Hypothetical
           protein F14F11.2 protein.
          Length = 77

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = +2

Query: 623 VPCMLVFN--YIRPKIFFQSRMTSF*GATSLRVIWRSKNVFYS 745
           V C+LV N  YI P  ++  ++ +   +  LR +  S+N F+S
Sbjct: 12  VACLLVSNAMYINPDYYYVEQLPTMKKSGQLRALAGSRNCFFS 54


>AC024791-30|AAL32250.2| 2460|Caenorhabditis elegans Hypothetical
            protein Y47G6A.29 protein.
          Length = 2460

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = -1

Query: 622  LYLRTAMLAYNS-NIHSTTGFSPLELLFGFKPYIPKSID 509
            L LR AM A N   +HST   +P   +  FKP +P   D
Sbjct: 2009 LVLRVAMEAKNELRMHSTAESTPRNEVKVFKPVVPNQYD 2047


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,849,057
Number of Sequences: 27780
Number of extensions: 351706
Number of successful extensions: 934
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 896
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 931
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2040452812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).