SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U97012-12|AAK39146.1|  310|Caenorhabditis elegans Serpentine rec...    30   1.5  
AF068714-9|AAC17810.1|   87|Caenorhabditis elegans Hypothetical ...    30   1.5  
AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like ...    29   3.5  
AC024847-10|AAF60859.1|  393|Caenorhabditis elegans Ground-like ...    29   3.5  
Z68215-1|CAA92450.1|  517|Caenorhabditis elegans Hypothetical pr...    28   6.0  
U97593-1|AAB52875.1|  715|Caenorhabditis elegans Hypothetical pr...    28   6.0  
AF016447-5|AAX22290.1|  397|Caenorhabditis elegans Serpentine re...    28   6.0  

>U97012-12|AAK39146.1|  310|Caenorhabditis elegans Serpentine
           receptor, class sx protein18 protein.
          Length = 310

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +1

Query: 583 DCLRFVLFDVFAILYEETLLISLCIPVCMYV 675
           +C RFV+  +FA+L++ TL + + I + + V
Sbjct: 78  ECFRFVVVYMFAVLFQSTLFLMMAIDLLLAV 108


>AF068714-9|AAC17810.1|   87|Caenorhabditis elegans Hypothetical
           protein B0348.1 protein.
          Length = 87

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +1

Query: 217 CVCSHTSRTRSARGPCTW 270
           C C+HT+R  S RG C W
Sbjct: 26  CQCNHTTRMESRRGNCWW 43


>AC024847-11|AAO21416.1|  453|Caenorhabditis elegans Ground-like
           (grd related) protein16, isoform b protein.
          Length = 453

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +1

Query: 190 SWPPCSGRGCVCSHTSRTRSARGPCTWAERPRLPPPVP 303
           S P C G    CS +S      G  ++A  P LPPP P
Sbjct: 31  SQPSCGGGAPPCSSSSYATGGGGG-SYAAAPALPPPPP 67


>AC024847-10|AAF60859.1|  393|Caenorhabditis elegans Ground-like
           (grd related) protein16, isoform a protein.
          Length = 393

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +1

Query: 190 SWPPCSGRGCVCSHTSRTRSARGPCTWAERPRLPPPVP 303
           S P C G    CS +S      G  ++A  P LPPP P
Sbjct: 31  SQPSCGGGAPPCSSSSYATGGGGG-SYAAAPALPPPPP 67


>Z68215-1|CAA92450.1|  517|Caenorhabditis elegans Hypothetical
           protein C53B4.1 protein.
          Length = 517

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = +3

Query: 576 IFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLV 713
           I  L  +C++ CL  + +G+  Y++ YT  Y   S       +SLV
Sbjct: 373 IAMLCYICILICLYLNWKGSFLYLSAYTLAYATQSLCLEAAYLSLV 418


>U97593-1|AAB52875.1|  715|Caenorhabditis elegans Hypothetical
           protein C46G7.3 protein.
          Length = 715

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -2

Query: 343 CR*HSYVVAGYVGR-GRAAV-SGDARPMYTVHAPTACGWCASRHSPARCR 200
           C   S+ V  ++    R AV +G+       ++   C +C+ RH PA CR
Sbjct: 633 CPLASFEVRRFIANDNRCAVCAGERHSSSMCYSTLKCTYCSGRHHPAGCR 682


>AF016447-5|AAX22290.1|  397|Caenorhabditis elegans Serpentine
           receptor, class b (beta)protein 19 protein.
          Length = 397

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = +2

Query: 644 YRYVYRYVCMSLVCISACMYVSRMYIGMY 730
           +RY+Y +  + L     C+Y+ R+   +Y
Sbjct: 169 FRYIYSFCTLGLAFCQYCVYIDRLLCALY 197


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,372,690
Number of Sequences: 27780
Number of extensions: 343851
Number of successful extensions: 1068
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1064
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1745954468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).