SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70783-10|CAC70122.1| 1037|Caenorhabditis elegans Hypothetical p...    29   4.1  
Z81109-12|CAE17917.2|  364|Caenorhabditis elegans Hypothetical p...    28   9.4  
Z71259-2|CAA95790.1|  336|Caenorhabditis elegans Hypothetical pr...    28   9.4  
Z49887-4|CAA90056.2|  213|Caenorhabditis elegans Hypothetical pr...    28   9.4  
U00032-6|AAA50634.1|  389|Caenorhabditis elegans Hypothetical pr...    28   9.4  
AF081125-1|AAC31954.1|  213|Caenorhabditis elegans ER lumen prot...    28   9.4  
AF026213-6|AAB71307.1|  655|Caenorhabditis elegans Temporarily a...    28   9.4  

>Z70783-10|CAC70122.1| 1037|Caenorhabditis elegans Hypothetical
           protein ZK856.13 protein.
          Length = 1037

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +2

Query: 530 TTIDQISNKAFACAYSVTKPTHWELRTL*FVATVLSTMTY 649
           TT   +SN    CA+ V K T+WE       ATV +  T+
Sbjct: 707 TTTPALSNTLKTCAFGVVKHTNWERLVKRLGATVEANGTF 746


>Z81109-12|CAE17917.2|  364|Caenorhabditis elegans Hypothetical
           protein R10D12.17 protein.
          Length = 364

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -1

Query: 206 KTNNFVFPLMSPPSDGFLLYFFKFIL 129
           K N+  F ++S P  G++L FF FIL
Sbjct: 119 KINDNRFQILSAPGFGWILIFFSFIL 144


>Z71259-2|CAA95790.1|  336|Caenorhabditis elegans Hypothetical
           protein F13G3.2 protein.
          Length = 336

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 4/52 (7%)
 Frame = +1

Query: 304 PFSSFSETNEQQFIF----IYIDRR*ISLLCVIHLFDVVVLSKFLSHTKQTE 447
           PFS FS+T   QF+F    I I    + L+ V  +  +++++K  +H+K +E
Sbjct: 181 PFSGFSDTRSFQFLFVTAAIAIGAYFVPLMSVFVIRKIMIVTK--AHSKMSE 230


>Z49887-4|CAA90056.2|  213|Caenorhabditis elegans Hypothetical
           protein F09B9.3 protein.
          Length = 213

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYL 104
           LK+ K+    GI  +  +LF L    R  D F  F S + T + +FYL
Sbjct: 21  LKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYNTAMKIFYL 68


>U00032-6|AAA50634.1|  389|Caenorhabditis elegans Hypothetical
           protein F37A4.6 protein.
          Length = 389

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = -1

Query: 251 RFKSLKKYENARNYIKTNNFVFPLMSPPSDGFLLYF 144
           R  SL   E+  NY KT   VFPL +     +LL F
Sbjct: 326 RRMSLSCLEDTSNYQKTQYLVFPLRTSSKKPYLLKF 361


>AF081125-1|AAC31954.1|  213|Caenorhabditis elegans ER lumen protein
           retaining receptor protein.
          Length = 213

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYL 104
           LK+ K+    GI  +  +LF L    R  D F  F S + T + +FYL
Sbjct: 21  LKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYNTAMKIFYL 68


>AF026213-6|AAB71307.1|  655|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 123 protein.
          Length = 655

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 711 MFFSILTIMVPIFYVYVMYVGFLIIAYFSQKI 806
           ++FS  +I V +F++    +GFL   YF +KI
Sbjct: 617 LYFSYTSIFVFMFFLMTGTIGFLATYYFVRKI 648


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,682,029
Number of Sequences: 27780
Number of extensions: 398804
Number of successful extensions: 940
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 911
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 940
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2061488408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).