SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48055-11|CAI58650.1| 1013|Caenorhabditis elegans Hypothetical p...    31   0.88 
Z29443-14|CAI59118.1| 1013|Caenorhabditis elegans Hypothetical p...    31   0.88 
Z50756-1|CAA90637.2|  737|Caenorhabditis elegans Hypothetical pr...    31   1.2  
AL021180-1|CAA15980.1|  383|Caenorhabditis elegans Hypothetical ...    29   4.7  
AF303252-1|AAG50210.1|  383|Caenorhabditis elegans 3E324 protein.      29   4.7  
Z81128-4|CAB03403.1|  898|Caenorhabditis elegans Hypothetical pr...    28   6.2  
U23511-1|AAC46791.1|  859|Caenorhabditis elegans Hypothetical pr...    28   6.2  
AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse trans...    28   8.2  
AF025462-7|AAB71003.1|  805|Caenorhabditis elegans Hypothetical ...    28   8.2  

>Z48055-11|CAI58650.1| 1013|Caenorhabditis elegans Hypothetical
           protein T07C4.10 protein.
          Length = 1013

 Score = 31.1 bits (67), Expect = 0.88
 Identities = 25/101 (24%), Positives = 44/101 (43%)
 Frame = +1

Query: 34  KLLEVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGI 213
           +L +++++ K  V     +   + ++LE  +++   +DEM  K   +     GLN KI  
Sbjct: 410 QLEKIQKENKTIVKENVYLSESKQVLLESEINLKNELDEMAVKLRNSQHQVAGLNEKISE 469

Query: 214 RGTDRLEILSNVAVFDESLSDTGGREKCLLRAHKSVSLTEE 336
               R +  ++V   DE        +K L  A  S  L EE
Sbjct: 470 EKRRRKKQDADVTRLDEQ------NQKLLREAQDSAELLEE 504


>Z29443-14|CAI59118.1| 1013|Caenorhabditis elegans Hypothetical
           protein T07C4.10 protein.
          Length = 1013

 Score = 31.1 bits (67), Expect = 0.88
 Identities = 25/101 (24%), Positives = 44/101 (43%)
 Frame = +1

Query: 34  KLLEVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGI 213
           +L +++++ K  V     +   + ++LE  +++   +DEM  K   +     GLN KI  
Sbjct: 410 QLEKIQKENKTIVKENVYLSESKQVLLESEINLKNELDEMAVKLRNSQHQVAGLNEKISE 469

Query: 214 RGTDRLEILSNVAVFDESLSDTGGREKCLLRAHKSVSLTEE 336
               R +  ++V   DE        +K L  A  S  L EE
Sbjct: 470 EKRRRKKQDADVTRLDEQ------NQKLLREAQDSAELLEE 504


>Z50756-1|CAA90637.2|  737|Caenorhabditis elegans Hypothetical
           protein T08D10.2 protein.
          Length = 737

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 3/72 (4%)
 Frame = +1

Query: 1   GSAAAGFQESGKLLEVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVD---EMEKKELR 171
           G+ AAG   + +LL     + +  + G T GR+R++I +H   I T  D    +++  + 
Sbjct: 181 GAGAAGIAAATQLLTFGFDVAVVEASGLTGGRVRSLISKHGELIETGCDSLRNLDESVIT 240

Query: 172 TSATETGLNSKI 207
           T   +  LN  I
Sbjct: 241 TLLHQVPLNENI 252


>AL021180-1|CAA15980.1|  383|Caenorhabditis elegans Hypothetical
           protein Y44F5A.1 protein.
          Length = 383

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = +1

Query: 199 SKIGIRGTDRLEILSNVAVFDESLS------DTGGREKCLLRAHKSVSLTEETGVLPMPT 360
           +K  IRG D  E    V    ++ S      DTG R +C+L+ H+SV     T  LP PT
Sbjct: 50  TKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCILKCHRSVPTAICT--LP-PT 106

Query: 361 DLRNLQV 381
            L++ Q+
Sbjct: 107 ALKSQQL 113


>AF303252-1|AAG50210.1|  383|Caenorhabditis elegans 3E324 protein.
          Length = 383

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = +1

Query: 199 SKIGIRGTDRLEILSNVAVFDESLS------DTGGREKCLLRAHKSVSLTEETGVLPMPT 360
           +K  IRG D  E    V    ++ S      DTG R +C+L+ H+SV     T  LP PT
Sbjct: 50  TKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCILKCHRSVPTAICT--LP-PT 106

Query: 361 DLRNLQV 381
            L++ Q+
Sbjct: 107 ALKSQQL 113


>Z81128-4|CAB03403.1|  898|Caenorhabditis elegans Hypothetical
           protein T23D8.4 protein.
          Length = 898

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +1

Query: 34  KLLEVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGI 213
           KLLEV E+ ++ + I     +I   I+     +   + +  + E   +  +T +NS + +
Sbjct: 331 KLLEVSEEKELGLGINV---KISFCIISALFELNAKISDHMEYETFMTTLQT-VNSLLDL 386

Query: 214 R-GTDRLEILSNVAVFDESLSD 276
             GTDR+++    A  DE+L D
Sbjct: 387 LIGTDRVKLSVTYAEEDENLKD 408


>U23511-1|AAC46791.1|  859|Caenorhabditis elegans Hypothetical
           protein C32D5.3 protein.
          Length = 859

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = -3

Query: 149 SSTAVGIDNVCSKMIALILPTVAPILTDIFN 57
           +ST +GI  V S ++++   ++ P+L  IFN
Sbjct: 322 ASTRIGIATVLSSIVSIAGTSIGPLLLSIFN 352


>AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse
           transcriptase protein.
          Length = 1066

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -3

Query: 191 PVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           P  +  V  SF   +  A G D + +  +      V  ++TD FN    S N P  WK
Sbjct: 549 PEEIRHVLRSF--PNGKAAGQDKISADFLKSCHDNVIDLITDRFNRYLHSRNVPKPWK 604


>AF025462-7|AAB71003.1|  805|Caenorhabditis elegans Hypothetical
           protein K10F12.5 protein.
          Length = 805

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -3

Query: 191 PVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           P  +  V  SF   +  A G D + +  +      V  ++TD FN    S N P  WK
Sbjct: 288 PEEIRHVLRSF--PNGKAAGQDKISADFLKSCHDNVIDLITDRFNRYLHSRNVPKPWK 343


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,995,440
Number of Sequences: 27780
Number of extensions: 359838
Number of successful extensions: 1008
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 960
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1788025660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).