SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79603-10|CAI79233.1|  224|Caenorhabditis elegans Hypothetical p...    31   1.3  
AL132898-11|CAB60945.4|  552|Caenorhabditis elegans Hypothetical...    29   3.1  
AC006669-1|AAF39909.1| 1203|Caenorhabditis elegans Hypothetical ...    29   3.1  
Z80344-2|CAB02487.3|  608|Caenorhabditis elegans Hypothetical pr...    29   4.1  
U97194-8|AAB52447.3| 1254|Caenorhabditis elegans Prion-like-(q/n...    29   4.1  
U23528-6|AAK31385.1|  216|Caenorhabditis elegans Hypothetical pr...    29   4.1  
AL032637-15|CAA21616.2|  370|Caenorhabditis elegans Hypothetical...    29   4.1  
AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical ...    29   4.1  
U21319-7|AAL16307.1|  469|Caenorhabditis elegans Hypothetical pr...    29   5.4  
Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical pr...    28   7.2  
Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical pr...    28   9.5  
Z49907-2|CAA90084.1|  324|Caenorhabditis elegans Hypothetical pr...    28   9.5  
Z47809-7|CAA87783.1|  662|Caenorhabditis elegans Hypothetical pr...    28   9.5  
Z47808-10|CAA87778.1|  662|Caenorhabditis elegans Hypothetical p...    28   9.5  
U58736-1|AAB00598.1|  302|Caenorhabditis elegans Dumpy : shorter...    28   9.5  
J03146-1|AAA65468.1|  324|Caenorhabditis elegans collagen protein.     28   9.5  

>Z79603-10|CAI79233.1|  224|Caenorhabditis elegans Hypothetical
           protein M163.11 protein.
          Length = 224

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 20/80 (25%), Positives = 41/80 (51%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  T +T +SS   + ++ +S S++   SSSA+ T          +STT++    T 
Sbjct: 45  SSSSSSTASTSSSSSTAATSSDDSSSSSSSSSSSASSTSSSDTTTADSSSTTSSDSSTTS 104

Query: 392 KTTPATMSAGNSSLFGKTTT 333
             + ++ S+ +S+    +T+
Sbjct: 105 SNSSSSTSSSDSTSVVSSTS 124


>AL132898-11|CAB60945.4|  552|Caenorhabditis elegans Hypothetical
           protein Y59A8B.22 protein.
          Length = 552

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = -1

Query: 174 FLIENREYRQGLKLDANVDSYGDRLVWGSNGTVADNPEYYGFIIQP 37
           + +  R   Q +K +  V    +  +W  +GT+ DN  Y GFII P
Sbjct: 120 YTVHTRTRLQEMKPETAVVREHEEFLW-LHGTLEDNENYAGFIIPP 164


>AC006669-1|AAF39909.1| 1203|Caenorhabditis elegans Hypothetical
            protein H43E16.1 protein.
          Length = 1203

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = -2

Query: 566  TSCGTRATRTSSKITSRANSNSYSTNR*LSS-SANITIKLSNWMLTLASTTTA*PGETEK 390
            ++ GT    T    +++ N N+ ST   ++  SA  +   S+    +AS+TTA PG +  
Sbjct: 889  STSGTTVVTTQGSSSTQTNPNTGSTGSTVTQPSAFSSTSASSSTQPIASSTTANPGSSTS 948

Query: 389  TTPATMSAGNSS 354
                  + G+SS
Sbjct: 949  GPTIASTQGSSS 960



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSS--ANITIKLSNWMLTLASTTTA*PGE 399
           S +   T+A  +SS +T+ A+S    T+   SSS  ++     S  ++T+++T T   G+
Sbjct: 472 SNSPTSTQAI-SSSTVTTVASSTIAPTSSQESSSIASSSAPSQSTTVITVSTTATVSSGQ 530

Query: 398 TEKTTPATMSAGNSSLFGKTT 336
           +  T   T+  G+S  FG +T
Sbjct: 531 STSTFGTTIGQGSS--FGSST 549



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = -2

Query: 572  SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSS---ANITIKLSNWMLTLASTTTA*PG 402
            S T   T+++  SS +T+  ++ S  TN+  SSS   A+ T  +++      S+T+    
Sbjct: 780  SSTMGSTQSSLPSSTMTNTGSTGSTVTNQLASSSTYGASSTEPIASSTANPGSSTSGQTA 839

Query: 401  ETEKTTPATMSAGNSSLFGKTTT 333
             T + + +T +  N+   G T T
Sbjct: 840  VTTQGSSSTQTNSNTGSTGSTVT 862


>Z80344-2|CAB02487.3|  608|Caenorhabditis elegans Hypothetical
           protein F15D4.4 protein.
          Length = 608

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 3/88 (3%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYST---NR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           S T+  T +T  S+  TS + S S ST       +S++  +   S+  +    T+T    
Sbjct: 519 STTTSSTTSTEASTPTTSTSTSTSTSTPSTTTSTTSTSTTSSTSSSAPIRAVRTSTPTTR 578

Query: 401 ETEKTTPATMSAGNSSLFGKTTT*YSRY 318
            T  TTP   +    ++FG+ +  ++ +
Sbjct: 579 RTTTTTPRRTTTPRKTIFGRMSDGWNNF 606


>U97194-8|AAB52447.3| 1254|Caenorhabditis elegans
            Prion-like-(q/n-rich)-domain-bearingprotein protein 20
            protein.
          Length = 1254

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 1/106 (0%)
 Frame = -3

Query: 415  PPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLET-GRERGQLRRQEDLGIE 239
            PP  G     + P     T   + +QQ+ +Q     +    +  G++ G    Q+ +G +
Sbjct: 727  PPPQGAFPPGYLPGGAQPTQQQIWQQQQQLQQQRMAMFQQQQAQGQQPGG--PQQPMG-Q 783

Query: 238  WFQ*EETHLVFIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPP 101
            W Q  +  + + PG    P AV  ++  +P  T   R  G    PP
Sbjct: 784  WPQQRQLPVPYPPGNNSTPDAVNQQQNPIPGATMQHRLSGEFAPPP 829


>U23528-6|AAK31385.1|  216|Caenorhabditis elegans Hypothetical
           protein B0034.4 protein.
          Length = 216

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = -3

Query: 184 PTA-VPHREPGVPAGTEAGRERGLIRGPPCVGEQ-RDSRRQPRV 59
           PTA  P +E  V A T+   ER + +GPP V E  +D ++ P V
Sbjct: 77  PTAPTPKKEKKVVATTKK-TERSVAQGPPLVSEHIKDEKKMPSV 119


>AL032637-15|CAA21616.2|  370|Caenorhabditis elegans Hypothetical
           protein Y43F8C.16 protein.
          Length = 370

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -2

Query: 479 SSSANITIKLSNWMLTLASTTTA*PGETEKTTPATMSAGNSSLFGKTT 336
           +S+ +IT    +   T+ STTTA P  T   TP T +   S++   TT
Sbjct: 150 TSTTSITTSTLSPPSTVQSTTTAKPTTTSTITPTTSADPTSTITTSTT 197


>AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical
           protein Y8A9A.2 protein.
          Length = 1360

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 23/80 (28%), Positives = 36/80 (45%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S TS  T  T TS+  ++  +++S +T     S+   T   S    T  STT +    T 
Sbjct: 185 STTSSTTTTTATSTTESTSTSTDSTTTESTTESTTEST-STSTDSTTTESTTESTTESTS 243

Query: 392 KTTPATMSAGNSSLFGKTTT 333
            +T +T +   S+    TTT
Sbjct: 244 TSTDSTTTESTSTSTDSTTT 263


>U21319-7|AAL16307.1|  469|Caenorhabditis elegans Hypothetical
           protein C30G12.1 protein.
          Length = 469

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 19/71 (26%), Positives = 35/71 (49%)
 Frame = -2

Query: 545 TRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPATMSA 366
           T+T+ +IT+   + +  T+  + ++     ++S   +   STTT  P   +  TPATM +
Sbjct: 287 TKTNPQITTTTMTTTTRTSTAIPTTTTTPRQISLQTIPF-STTTRQPNFDKTKTPATMPS 345

Query: 365 GNSSLFGKTTT 333
            +SS      T
Sbjct: 346 ASSSSLSSIQT 356


>Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical
           protein T07D4.4c protein.
          Length = 613

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +3

Query: 96  TQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           ++GG    P++  A  P  + GS  GT VG+P +PG
Sbjct: 47  SRGGMFGGPKASNAPPPQTSFGSTSGTRVGVPIMPG 82


>Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical
           protein C30H6.11 protein.
          Length = 460

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 20/79 (25%), Positives = 33/79 (41%)
 Frame = -2

Query: 569 RTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEK 390
           +  C T +T T+S  T+   +   +T    +++       +    T   TTT    ET  
Sbjct: 59  KADCTTTSTTTTSTTTTTTPTTPTTTTTTPTTTTTTPTTTTTTPTTTTETTTTPTTET-T 117

Query: 389 TTPATMSAGNSSLFGKTTT 333
           TTP T +   ++    TTT
Sbjct: 118 TTPTTTTPTTTTTTPTTTT 136



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 20/78 (25%), Positives = 33/78 (42%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  T+     + +T    +++A  T   +    T   TTT     T  T
Sbjct: 163 TTTTTPTTTTTTPTTTTTTPTTTTTTPTTTTTAPTTTTTTPTTTTTTPTTTTTVPTTTTT 222

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 223 TPTTTTTTTTTPTTTTTT 240


>Z49907-2|CAA90084.1|  324|Caenorhabditis elegans Hypothetical
           protein B0491.2 protein.
          Length = 324

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = -3

Query: 325 QDTEHRIRDVLETGRERGQLRRQEDLGIEWFQ*EETHLVFIPGKGGRPTAVPHREPGVP 149
           Q T    +D++  GR   ++RRQ          EET+    P   G P+A P + P VP
Sbjct: 48  QSTNGLWKDIVVIGRSSKRVRRQY---------EETNATPTPHADGSPSAPPGQPPAVP 97


>Z47809-7|CAA87783.1|  662|Caenorhabditis elegans Hypothetical
           protein D2013.9 protein.
          Length = 662

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 96  WGSNGTVADNPEYYGFIIQPW 34
           W SN   A +PE+  +I QPW
Sbjct: 255 WASNVITAQHPEWRKYIEQPW 275


>Z47808-10|CAA87778.1|  662|Caenorhabditis elegans Hypothetical
           protein D2013.9 protein.
          Length = 662

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 96  WGSNGTVADNPEYYGFIIQPW 34
           W SN   A +PE+  +I QPW
Sbjct: 255 WASNVITAQHPEWRKYIEQPW 275


>U58736-1|AAB00598.1|  302|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 3 protein.
          Length = 302

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = -3

Query: 202 PGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPP 101
           PG+ GRP A P R PG P     GR+  L+ GPP
Sbjct: 119 PGRDGRPGA-PGR-PGNPG--PPGRDGALLPGPP 148


>J03146-1|AAA65468.1|  324|Caenorhabditis elegans collagen protein.
          Length = 324

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = -3

Query: 325 QDTEHRIRDVLETGRERGQLRRQEDLGIEWFQ*EETHLVFIPGKGGRPTAVPHREPGVP 149
           Q T    +D++  GR   ++RRQ          EET+    P   G P+A P + P VP
Sbjct: 48  QSTNGLWKDIVVIGRSSKRVRRQY---------EETNATPTPHADGSPSAPPGQPPAVP 97


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,803,434
Number of Sequences: 27780
Number of extensions: 379707
Number of successful extensions: 1391
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1374
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2077023564
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).