SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81057-6|CAB02913.1|  221|Caenorhabditis elegans Hypothetical pr...   307   6e-84
D85499-1|BAA12821.1|  221|Caenorhabditis elegans manganese super...   307   6e-84
D12984-1|BAA02363.1|  221|Caenorhabditis elegans manganese super...   307   6e-84
X85790-1|CAA59790.1|  218|Caenorhabditis elegans mangenese super...   291   3e-79
X77021-1|CAA54319.1|  218|Caenorhabditis elegans manganese super...   291   3e-79
U42844-5|AAB53822.1|  218|Caenorhabditis elegans Sod (superoxide...   291   3e-79
Z81545-2|CAB04438.1|  212|Caenorhabditis elegans Hypothetical pr...    33   0.36 
Z82288-5|CAB05324.1|  380|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z81555-3|CAB04513.1|  221|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AF026555-1|AAB97516.1|  221|Caenorhabditis elegans GATA transcri...    28   7.8  
AC006603-7|ABB51201.1|  576|Caenorhabditis elegans Hypothetical ...    28   7.8  

>Z81057-6|CAB02913.1|  221|Caenorhabditis elegans Hypothetical
           protein F10D11.1 protein.
          Length = 221

 Score =  307 bits (754), Expect = 6e-84
 Identities = 139/215 (64%), Positives = 171/215 (79%)
 Frame = +3

Query: 87  IMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNV 266
           +  +S+ +  +  VA A R KH+LP+LPY+Y  LEPVIS EIM LHH KHHATY+NNLN 
Sbjct: 6   VRCVSKLVQPITGVA-AVRSKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQ 64

Query: 267 AEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDF 446
            EEKL +A +KG++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L  A++ DF
Sbjct: 65  IEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDF 124

Query: 447 GSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVW 626
           GS DN++ QLS ++VAVQGSGWGWLGY  + K L++ATC NQDPL+ATTGLVPLFGIDVW
Sbjct: 125 GSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVW 184

Query: 627 EHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           EHAYYLQYKNVR DYV AI+ +ANW ++S+R+ KA
Sbjct: 185 EHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKA 219


>D85499-1|BAA12821.1|  221|Caenorhabditis elegans manganese
           superoxide dismutase protein.
          Length = 221

 Score =  307 bits (754), Expect = 6e-84
 Identities = 139/215 (64%), Positives = 171/215 (79%)
 Frame = +3

Query: 87  IMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNV 266
           +  +S+ +  +  VA A R KH+LP+LPY+Y  LEPVIS EIM LHH KHHATY+NNLN 
Sbjct: 6   VRCVSKLVQPITGVA-AVRSKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQ 64

Query: 267 AEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDF 446
            EEKL +A +KG++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L  A++ DF
Sbjct: 65  IEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDF 124

Query: 447 GSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVW 626
           GS DN++ QLS ++VAVQGSGWGWLGY  + K L++ATC NQDPL+ATTGLVPLFGIDVW
Sbjct: 125 GSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVW 184

Query: 627 EHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           EHAYYLQYKNVR DYV AI+ +ANW ++S+R+ KA
Sbjct: 185 EHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKA 219


>D12984-1|BAA02363.1|  221|Caenorhabditis elegans manganese
           superoxide dismutaseprecursor protein.
          Length = 221

 Score =  307 bits (754), Expect = 6e-84
 Identities = 139/215 (64%), Positives = 171/215 (79%)
 Frame = +3

Query: 87  IMLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNV 266
           +  +S+ +  +  VA A R KH+LP+LPY+Y  LEPVIS EIM LHH KHHATY+NNLN 
Sbjct: 6   VRCVSKLVQPITGVA-AVRSKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQ 64

Query: 267 AEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDF 446
            EEKL +A +KG++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L  A++ DF
Sbjct: 65  IEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDF 124

Query: 447 GSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVW 626
           GS DN++ QLS ++VAVQGSGWGWLGY  + K L++ATC NQDPL+ATTGLVPLFGIDVW
Sbjct: 125 GSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVW 184

Query: 627 EHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           EHAYYLQYKNVR DYV AI+ +ANW ++S+R+ KA
Sbjct: 185 EHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKA 219


>X85790-1|CAA59790.1|  218|Caenorhabditis elegans mangenese
           superoxide dismutase protein.
          Length = 218

 Score =  291 bits (715), Expect = 3e-79
 Identities = 134/204 (65%), Positives = 162/204 (79%), Gaps = 2/204 (0%)
 Frame = +3

Query: 126 VAG--ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           VAG  A R KHTLP+LP++Y  LEPVIS EIM LHH KHHATY+NNLN  EEKL +A +K
Sbjct: 16  VAGVLAVRSKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSK 75

Query: 300 GDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLS 479
           G++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L   +++DFGS DN++ +LS
Sbjct: 76  GNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLS 135

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNV 659
             ++AVQGSGWGWLGY K+ K L+IATC NQDPL+   G+VPLFGIDVWEHAYYLQYKNV
Sbjct: 136 DITIAVQGSGWGWLGYCKKDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNV 192

Query: 660 RADYVKAIFDVANWNDISQRYEKA 731
           R DYV AI+ +ANW +IS+R+  A
Sbjct: 193 RPDYVHAIWKIANWKNISERFANA 216


>X77021-1|CAA54319.1|  218|Caenorhabditis elegans manganese
           superoxide dismutase protein.
          Length = 218

 Score =  291 bits (715), Expect = 3e-79
 Identities = 134/204 (65%), Positives = 162/204 (79%), Gaps = 2/204 (0%)
 Frame = +3

Query: 126 VAG--ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           VAG  A R KHTLP+LP++Y  LEPVIS EIM LHH KHHATY+NNLN  EEKL +A +K
Sbjct: 16  VAGVLAVRSKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSK 75

Query: 300 GDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLS 479
           G++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L   +++DFGS DN++ +LS
Sbjct: 76  GNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLS 135

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNV 659
             ++AVQGSGWGWLGY K+ K L+IATC NQDPL+   G+VPLFGIDVWEHAYYLQYKNV
Sbjct: 136 DITIAVQGSGWGWLGYCKKDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNV 192

Query: 660 RADYVKAIFDVANWNDISQRYEKA 731
           R DYV AI+ +ANW +IS+R+  A
Sbjct: 193 RPDYVHAIWKIANWKNISERFANA 216


>U42844-5|AAB53822.1|  218|Caenorhabditis elegans Sod (superoxide
           dismutase) protein3 protein.
          Length = 218

 Score =  291 bits (715), Expect = 3e-79
 Identities = 134/204 (65%), Positives = 162/204 (79%), Gaps = 2/204 (0%)
 Frame = +3

Query: 126 VAG--ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           VAG  A R KHTLP+LP++Y  LEPVIS EIM LHH KHHATY+NNLN  EEKL +A +K
Sbjct: 16  VAGVLAVRSKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSK 75

Query: 300 GDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLS 479
           G++   I L PALKFNGGGHINHSIFW NL+ +GG+PS  L   +++DFGS DN++ +LS
Sbjct: 76  GNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLS 135

Query: 480 TASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNV 659
             ++AVQGSGWGWLGY K+ K L+IATC NQDPL+   G+VPLFGIDVWEHAYYLQYKNV
Sbjct: 136 DITIAVQGSGWGWLGYCKKDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNV 192

Query: 660 RADYVKAIFDVANWNDISQRYEKA 731
           R DYV AI+ +ANW +IS+R+  A
Sbjct: 193 RPDYVHAIWKIANWKNISERFANA 216


>Z81545-2|CAB04438.1|  212|Caenorhabditis elegans Hypothetical
           protein F49H6.2 protein.
          Length = 212

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +2

Query: 467 ESTVDSFCGSTGLRLGLAWLQQTNEEIANSYMPEPGSSAGHHWIGPALRNRCMGA 631
           + T DS C S G  L     Q+  + +ANS++   G+S+   WIG      CM +
Sbjct: 90  QPTADSLCSSEGAVLSSIQSQEELDYMANSFIALNGASSA-FWIGAERTAACMSS 143


>Z82288-5|CAB05324.1|  380|Caenorhabditis elegans Hypothetical
           protein ZK896.7 protein.
          Length = 380

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +2

Query: 461 HKESTVDSFCGSTGLRLGLAWLQQTNEEIANSYMPEPGSSAGHHWIG 601
           H  +T   +C S G  L       T+  +A+S   E GS+ G  WIG
Sbjct: 42  HTYNTAKEYCDSHGYSLATVDNAITSNFLASSAATEFGSNNGQFWIG 88


>Z81555-3|CAB04513.1|  221|Caenorhabditis elegans Hypothetical
           protein F58E10.2 protein.
          Length = 221

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 564 QNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
           Q+ DP Q +T + P+FG     + Y  QY  +  DY
Sbjct: 72  QSYDPAQQSTPVHPMFGSLDMMNCYSQQYPQIGQDY 107


>AF026555-1|AAB97516.1|  221|Caenorhabditis elegans GATA
           transcription factor END-1 protein.
          Length = 221

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 564 QNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADY 671
           Q+ DP Q +T + P+FG     + Y  QY  +  DY
Sbjct: 72  QSYDPAQQSTPVHPMFGSLDMMNCYSQQYPQIGQDY 107


>AC006603-7|ABB51201.1|  576|Caenorhabditis elegans Hypothetical
           protein B0524.7 protein.
          Length = 576

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 6/76 (7%)
 Frame = +3

Query: 249 INNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIF---WH---NLSPNGGKP 410
           + N      K A+   K    +  N +  LK NG   INH +    W     +  NG  P
Sbjct: 358 LRNAKQKAAKRARKLVKNWKKSAQNKSGVLKINGNHVINHDVVVKKWKVELKIEGNGESP 417

Query: 411 SDVLTKAVEKDFGSWD 458
             V+ KA E   G WD
Sbjct: 418 RKVVRKAKETS-GYWD 432


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,787,732
Number of Sequences: 27780
Number of extensions: 437899
Number of successful extensions: 1143
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1076
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1139
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2244863852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).