SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U23511-11|AAC46797.1|  123|Caenorhabditis elegans Lc3, gabarap a...   213   9e-56
AF326943-1|AAG49393.1|  123|Caenorhabditis elegans GABA A recept...   213   9e-56
Z69385-5|CAA93421.1|  130|Caenorhabditis elegans Hypothetical pr...    83   1e-16
Z81064-1|CAB02962.2|  655|Caenorhabditis elegans Hypothetical pr...    29   2.8  
AF026204-2|AAB71251.2|  247|Caenorhabditis elegans Hypothetical ...    29   2.8  
Z77662-5|CAB01192.2|  579|Caenorhabditis elegans Hypothetical pr...    29   3.7  
Z70780-6|CAA94823.1|  614|Caenorhabditis elegans Hypothetical pr...    27   8.6  
Z29443-6|CAA82573.2|  280|Caenorhabditis elegans Hypothetical pr...    27   8.6  
U64833-4|AAB04817.1|  380|Caenorhabditis elegans Hypothetical pr...    27   8.6  
L26545-2|AAA20080.1|  280|Caenorhabditis elegans CED-9 protein.        27   8.6  
AF000298-1|AAC48257.2|  229|Caenorhabditis elegans Pcna (prolife...    27   8.6  

>U23511-11|AAC46797.1|  123|Caenorhabditis elegans Lc3, gabarap and
           gate-16 familyprotein 1 protein.
          Length = 123

 Score =  213 bits (520), Expect = 9e-56
 Identities = 96/116 (82%), Positives = 108/116 (93%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ YKEE++FEKR+AEG+KIRRKYPDR+PVIVEKAPK++L DLDKKKYLVPSDLTVGQF
Sbjct: 1   MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRI LRPEDALFFFVNNVIP T  TMG LYQ+HH+ED FLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG 116


>AF326943-1|AAG49393.1|  123|Caenorhabditis elegans GABA A
           receptor-associated protein protein.
          Length = 123

 Score =  213 bits (520), Expect = 9e-56
 Identities = 96/116 (82%), Positives = 108/116 (93%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ YKEE++FEKR+AEG+KIRRKYPDR+PVIVEKAPK++L DLDKKKYLVPSDLTVGQF
Sbjct: 1   MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRI LRPEDALFFFVNNVIP T  TMG LYQ+HH+ED FLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG 116


>Z69385-5|CAA93421.1|  130|Caenorhabditis elegans Hypothetical
           protein ZK593.6 protein.
          Length = 130

 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 39/114 (34%), Positives = 69/114 (60%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +KE   F +R+ + E+IR + P++VPVI+E+    R L  +D+ K+LVP  +TV +   +
Sbjct: 17  FKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSI 76

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           +R+R+ L P+ A F  VN   +   S +M +LY +  D D F+Y+ ++ +  +G
Sbjct: 77  VRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 130


>Z81064-1|CAB02962.2|  655|Caenorhabditis elegans Hypothetical
           protein F16B12.1 protein.
          Length = 655

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = -1

Query: 125 DLDISCGFFRPQPFSSQMNVL-LCIGISC*YFITHCNFR 12
           D D SC FF  + FSS+  +L L     C Y   H  F+
Sbjct: 364 DPDCSCNFFNDKTFSSEGKMLNLSFPAHCAYIYCHFQFK 402


>AF026204-2|AAB71251.2|  247|Caenorhabditis elegans Hypothetical
           protein C30E1.6 protein.
          Length = 247

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 10/28 (35%), Positives = 20/28 (71%)
 Frame = +1

Query: 421 SFTLSDHMVKFNLSLRLKLCIILWYFFY 504
           SFT+ +  + F++ L  KL +++++FFY
Sbjct: 116 SFTIPNFSISFSIFLWAKLQVLIYFFFY 143


>Z77662-5|CAB01192.2|  579|Caenorhabditis elegans Hypothetical
           protein F47B8.5 protein.
          Length = 579

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -1

Query: 116 ISCGFFRPQPFSSQMNVLLCIGISC*YFITHCNF 15
           I  G   P   SS MN+LL   +S   F  HC +
Sbjct: 353 IENGIISPSNSSSSMNLLLIFAVSTLIFSAHCQY 386


>Z70780-6|CAA94823.1|  614|Caenorhabditis elegans Hypothetical
           protein F46B6.7 protein.
          Length = 614

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 329 QEHHDEDFFLYIAFSDENVYGN*FQIIHFQIVLHYLTI 442
           +E  D  F L   F   N  GN  +IIH   ++H+L +
Sbjct: 296 REREDTSFQLQCIFCRYNARGNRSKIIHHLYMIHHLNL 333


>Z29443-6|CAA82573.2|  280|Caenorhabditis elegans Hypothetical
           protein T07C4.8 protein.
          Length = 280

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +3

Query: 540 MNSIKLFKQVRDCFVFTSLF 599
           M S++L  QVR+ FV+TSLF
Sbjct: 186 MESVELQGQVRNLFVYTSLF 205


>U64833-4|AAB04817.1|  380|Caenorhabditis elegans Hypothetical
           protein B0507.7 protein.
          Length = 380

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = -1

Query: 401 GINFHRHFRRKMLCIKRNLHHGVLDRETPLLQMWVE*HCSRRRKVRLQAAGEYVSGS--R 228
           G++ +    +K+L + + LHH +LD E  L  +  +    ++ ++  Q    +VS +  R
Sbjct: 182 GLSKYADKNQKILNLNQELHHTILDGENRLGHINEDRFEDQKNQLEKQDDTCFVSKNHRR 241

Query: 227 SRTGQLLNQTELN 189
            R G+ L  TE++
Sbjct: 242 MRIGEALLDTEMD 254


>L26545-2|AAA20080.1|  280|Caenorhabditis elegans CED-9 protein.
          Length = 280

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +3

Query: 540 MNSIKLFKQVRDCFVFTSLF 599
           M S++L  QVR+ FV+TSLF
Sbjct: 186 MESVELQGQVRNLFVYTSLF 205


>AF000298-1|AAC48257.2|  229|Caenorhabditis elegans Pcna
           (proliferating cell nuclearantigen) homolog protein 1
           protein.
          Length = 229

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +2

Query: 38  INMKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVE 145
           +N+ F  K  + F K  A  +++R    + VPV+VE
Sbjct: 170 VNVNFSIKYMNQFTKATALSDRVRLSLCNDVPVVVE 205


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,408,021
Number of Sequences: 27780
Number of extensions: 313385
Number of successful extensions: 1092
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1046
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1090
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1423653030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).