SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF036705-10|AAB95167.2|  612|Caenorhabditis elegans Hypothetical...    32   0.70 
Z70271-4|CAA94235.1| 1026|Caenorhabditis elegans Hypothetical pr...    31   1.2  
Z82266-13|CAB05187.1| 1080|Caenorhabditis elegans Hypothetical p...    30   2.1  
Z68295-2|CAA92588.1| 1080|Caenorhabditis elegans Hypothetical pr...    30   2.1  
Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical pr...    29   6.5  
Z81564-4|CAB04574.1|  432|Caenorhabditis elegans Hypothetical pr...    29   6.5  
AC006615-3|AAK68232.1| 1148|Caenorhabditis elegans Hypothetical ...    29   6.5  
AC006615-2|AAK68231.1| 1121|Caenorhabditis elegans Hypothetical ...    29   6.5  
AF063007-2|AAC16433.1|  583|Caenorhabditis elegans Hypothetical ...    28   8.6  
AF036705-9|AAO91724.1|  686|Caenorhabditis elegans Hypothetical ...    28   8.6  

>AF036705-10|AAB95167.2|  612|Caenorhabditis elegans Hypothetical
           protein F37C4.1 protein.
          Length = 612

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +3

Query: 516 LYLGHWPLWSGCQLSCRVSEQHDSPSLGEELGPAVLTAPNIQ--LMRFSDSTLASLI 680
           LYL HWP+++  +L+C  ++   + +L   +  AV+T  N +   +R S +++  L+
Sbjct: 249 LYLIHWPIYAYWKLTCNGNQISLAVALASSIVFAVITYENFEKWYLRLSSTSIGLLV 305


>Z70271-4|CAA94235.1| 1026|Caenorhabditis elegans Hypothetical protein
            W08D2.7 protein.
          Length = 1026

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 3    RTACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMY-PGLAGKIIRWI 176
            + A P+L + +   L  L  + +N+AKV ++C + + +  D+ V  + PGL   + +W+
Sbjct: 902  KCAAPKLATELQTCLSELHEQARNVAKVSNECKMEVME--DKYVSSFNPGLMDVVYQWV 958


>Z82266-13|CAB05187.1| 1080|Caenorhabditis elegans Hypothetical
           protein F23B2.12 protein.
          Length = 1080

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/43 (25%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 IEGLSLPVDDDFDPTIQLDNLGPKTIPASTIDVKLWAQTICTQ 509
           ++G + P+D  +   +  D+LG +++ +  ID ++W   +CT+
Sbjct: 321 LDGFAGPMDISYQDFV--DSLGDQSVDSGWIDNRIWQYQVCTE 361


>Z68295-2|CAA92588.1| 1080|Caenorhabditis elegans Hypothetical
           protein F23B2.12 protein.
          Length = 1080

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/43 (25%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 IEGLSLPVDDDFDPTIQLDNLGPKTIPASTIDVKLWAQTICTQ 509
           ++G + P+D  +   +  D+LG +++ +  ID ++W   +CT+
Sbjct: 321 LDGFAGPMDISYQDFV--DSLGDQSVDSGWIDNRIWQYQVCTE 361


>Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical
           protein F55G11.9 protein.
          Length = 1431

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +3

Query: 42  LLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQLSTS 206
           L+  L   +K   KV +D +L   + TD+   +   L+G + R +C C+A +  S
Sbjct: 543 LVNALKGGSKLTFKVEADSLLQQIELTDKRDTLAKNLSGGMKRKLCVCMAMIGGS 597


>Z81564-4|CAB04574.1|  432|Caenorhabditis elegans Hypothetical
           protein K05C4.4 protein.
          Length = 432

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +1

Query: 469 RSTSSFGLKRYALSWYCTSGTGLYGADANCPVVFPSNTTVRPWARSWA 612
           RS +  G+K++    +C +    +    NC V+  SN  ++ +ARS+A
Sbjct: 322 RSINLEGIKKFTARDHCLNSLRNFPYLPNCTVLGLSNNNIKEFARSFA 369


>AC006615-3|AAK68232.1| 1148|Caenorhabditis elegans Hypothetical
           protein C36B7.5b protein.
          Length = 1148

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +3

Query: 519 YLGHWPLWSGCQLSC 563
           Y G W  WSGC +SC
Sbjct: 595 YWGDWTPWSGCSVSC 609


>AC006615-2|AAK68231.1| 1121|Caenorhabditis elegans Hypothetical
           protein C36B7.5a protein.
          Length = 1121

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +3

Query: 519 YLGHWPLWSGCQLSC 563
           Y G W  WSGC +SC
Sbjct: 595 YWGDWTPWSGCSVSC 609


>AF063007-2|AAC16433.1|  583|Caenorhabditis elegans Hypothetical
           protein R119.7 protein.
          Length = 583

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -2

Query: 445 PRLSSCIV-GSKSSSTGRLRPSMSDPFAPFITAYNTLKI 332
           PR SS +V  SKS  +G     ++ P  P + AY+ L++
Sbjct: 321 PRTSSPVVYASKSKPSGHYDDKIASPHDPAVLAYSRLRV 359


>AF036705-9|AAO91724.1|  686|Caenorhabditis elegans Hypothetical
           protein F37C4.2 protein.
          Length = 686

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 516 LYLGHWPLWSGCQLSCRVSEQHDSPSLGEELGPAVLTAPNIQ--LMRFSDSTLASLI 680
           LYL HWP+++  +L+C  S    + +L   +  AV+T    +   +R + +++  L+
Sbjct: 323 LYLIHWPIYAYWKLTCNGSHVLLALALASSIVLAVITYETFEKWYLRLTSTSIGILV 379


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,524,596
Number of Sequences: 27780
Number of extensions: 463402
Number of successful extensions: 1336
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1241
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1336
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2486134266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).