SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41543-2|AAO21426.1|  359|Caenorhabditis elegans Hypothetical pr...   272   2e-73
U41543-1|AAB37022.2|  396|Caenorhabditis elegans Hypothetical pr...   272   2e-73
AF043703-6|AAK21503.1|  399|Caenorhabditis elegans Hypothetical ...   258   4e-69
AF003148-10|AAB54206.2|  427|Caenorhabditis elegans Hypothetical...   256   9e-69
Z83109-2|CAB05517.1|  372|Caenorhabditis elegans Hypothetical pr...   256   1e-68
Z75714-4|CAB00062.1|  360|Caenorhabditis elegans Hypothetical pr...   256   2e-68
U80451-10|AAB37844.1|  106|Caenorhabditis elegans Hypothetical p...    75   4e-14
AC006661-7|AAF39888.2| 1427|Caenorhabditis elegans Hypothetical ...    30   1.5  
Z82072-2|CAB04921.1|  329|Caenorhabditis elegans Hypothetical pr...    29   4.6  
Z81029-8|CAB02702.1|  329|Caenorhabditis elegans Hypothetical pr...    29   4.6  

>U41543-2|AAO21426.1|  359|Caenorhabditis elegans Hypothetical
           protein F46H5.3b protein.
          Length = 359

 Score =  272 bits (666), Expect = 2e-73
 Identities = 124/187 (66%), Positives = 147/187 (78%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GM+KE Q QLI DHFLFKEGDRF+QAANACR+WP GRGI+HN  KTFL+WCNEEDHL
Sbjct: 173 PLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHL 232

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GG++ QV +RL+  V  IEK+ PFS  DRLG+LTFCP+NLGTTVRASVHI   
Sbjct: 233 RIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHI-RL 291

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    + +     LQ+RG  GEH+E+EGGVYDISNK R+GLTE++AVK+MYDGIA 
Sbjct: 292 PKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAH 351

Query: 202 LIKIEKS 182
           LI +EK+
Sbjct: 352 LIALEKA 358


>U41543-1|AAB37022.2|  396|Caenorhabditis elegans Hypothetical
           protein F46H5.3a protein.
          Length = 396

 Score =  272 bits (666), Expect = 2e-73
 Identities = 124/187 (66%), Positives = 147/187 (78%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GM+KE Q QLI DHFLFKEGDRF+QAANACR+WP GRGI+HN  KTFL+WCNEEDHL
Sbjct: 210 PLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHL 269

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GG++ QV +RL+  V  IEK+ PFS  DRLG+LTFCP+NLGTTVRASVHI   
Sbjct: 270 RIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHI-RL 328

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    + +     LQ+RG  GEH+E+EGGVYDISNK R+GLTE++AVK+MYDGIA 
Sbjct: 329 PKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAH 388

Query: 202 LIKIEKS 182
           LI +EK+
Sbjct: 389 LIALEKA 395


>AF043703-6|AAK21503.1|  399|Caenorhabditis elegans Hypothetical
           protein W10C8.5 protein.
          Length = 399

 Score =  258 bits (631), Expect = 4e-69
 Identities = 118/186 (63%), Positives = 144/186 (77%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GM K+TQ+QLI DHFLFKEGDR +Q ANAC FWP GRGI+HN +KTFL+W NEEDH+
Sbjct: 212 PLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHM 271

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ G D+  V  RL+  V  IEK++PFS  DRLG+LTFCPTNLG+TVRASVHI   
Sbjct: 272 RIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALP 331

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   + E+  K +LQVRG  GEH+E+ GGVYDISNK R+GL+EY AVK+MYDG+ +
Sbjct: 332 KLAARKDFI-EICEKLNLQVRGIHGEHSESVGGVYDISNKARLGLSEYQAVKQMYDGVKK 390

Query: 202 LIKIEK 185
           LI++E+
Sbjct: 391 LIEMEE 396


>AF003148-10|AAB54206.2|  427|Caenorhabditis elegans Hypothetical
           protein F32B5.1 protein.
          Length = 427

 Score =  256 bits (628), Expect = 9e-69
 Identities = 117/186 (62%), Positives = 144/186 (77%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GM K+TQ+QLI DHFLFKEGDR +Q ANAC FWP GRGI+HN +KTFL+W NEEDH+
Sbjct: 240 PLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHM 299

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ G D+  V  RL+  V  IEK++PFS  DRLG+LTFCPTNLG+TVRASVHI   
Sbjct: 300 RIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALP 359

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   + E+  K +LQVRG  GEH+++ GGVYDISNK R+GL+EY AVK+MYDG+ +
Sbjct: 360 KLAARKDFI-EICEKLNLQVRGIHGEHSDSVGGVYDISNKARLGLSEYQAVKQMYDGVKK 418

Query: 202 LIKIEK 185
           LI++E+
Sbjct: 419 LIEMEE 424


>Z83109-2|CAB05517.1|  372|Caenorhabditis elegans Hypothetical
           protein F44G3.2 protein.
          Length = 372

 Score =  256 bits (627), Expect = 1e-68
 Identities = 117/186 (62%), Positives = 143/186 (76%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GMSK+TQ QLI DHFLFKEGDR +Q ANAC FWP GRGI+HN  KTFL+W NEEDHL
Sbjct: 185 PLDGMSKDTQNQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNKKTFLIWVNEEDHL 244

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ G D+  V +RL+  V  IEK++ FS  DRLG+LTFCPTNLG+TVRASVHI   
Sbjct: 245 RIISMQEGSDVGAVLERLIKGVRGIEKQVQFSRDDRLGWLTFCPTNLGSTVRASVHI-AL 303

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    +++  K  LQ+RG  GEH+E+EGGVYDISN+ R+GL+EY+AVK+MYDG+  
Sbjct: 304 PKLSAREDFKQICDKLDLQLRGIHGEHSESEGGVYDISNRARLGLSEYEAVKKMYDGVKN 363

Query: 202 LIKIEK 185
           LI++E+
Sbjct: 364 LIEMEE 369


>Z75714-4|CAB00062.1|  360|Caenorhabditis elegans Hypothetical
           protein ZC434.8 protein.
          Length = 360

 Score =  256 bits (626), Expect = 2e-68
 Identities = 115/187 (61%), Positives = 148/187 (79%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM +ET+++LI DHFLFKEGDRF++AANA R+WP GRGI+HNE KTFLVW NEEDHL
Sbjct: 173 PLTGMDEETKKKLIADHFLFKEGDRFLKAANANRYWPNGRGIFHNEKKTFLVWVNEEDHL 232

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GG++ +V  RL+  +N +  K PF+ H RLG+LTFCPTNLGTTVRASVHI   
Sbjct: 233 RIISMQNGGNVGEVLARLIKGLNLVAAKAPFARHPRLGWLTFCPTNLGTTVRASVHI-KL 291

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    +++ S   LQ+RG  GEH+E++ G+YDISNK+R+GLTEY AV++MYDG+ +
Sbjct: 292 PKISAKDDFKKICSDMKLQIRGIHGEHSESKEGIYDISNKQRLGLTEYQAVRQMYDGLKK 351

Query: 202 LIKIEKS 182
           LI++EK+
Sbjct: 352 LIELEKA 358


>U80451-10|AAB37844.1|  106|Caenorhabditis elegans Hypothetical
           protein F11G11.13 protein.
          Length = 106

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 55/76 (72%)
 Frame = -3

Query: 418 TTVRASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEY 239
           T++++SVHI            +++ S+  LQ+RG  GE+++ + G+YDISNK+R+GLTEY
Sbjct: 24  TSLKSSVHIKLPKISAKDDF-KKICSEMKLQIRGIHGEYSDLKEGIYDISNKQRLGLTEY 82

Query: 238 DAVKEMYDGIAELIKI 191
            AV++MYDG+ +LI++
Sbjct: 83  QAVRQMYDGLKKLIEL 98


>AC006661-7|AAF39888.2| 1427|Caenorhabditis elegans Hypothetical
           protein H20J04.2 protein.
          Length = 1427

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%)
 Frame = -2

Query: 542 GRRP---AAGVQEAGERRQRDREEDPVLAPRPARLPHVLPDQ 426
           GR P    AG  E  E++ +  E DP   PRP   P   P+Q
Sbjct: 271 GRAPNTLKAGDHERKEKKPKKEERDPAAPPRPRGRPPKTPEQ 312


>Z82072-2|CAB04921.1|  329|Caenorhabditis elegans Hypothetical
           protein W05H12.2 protein.
          Length = 329

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = -3

Query: 475 PFSHHDRLGFLTFCPTNLGTTVRASVH 395
           P  H DRL  LTFC  +  T V   +H
Sbjct: 194 PVRHRDRLALLTFCDIDTQTIVLWRIH 220


>Z81029-8|CAB02702.1|  329|Caenorhabditis elegans Hypothetical
           protein W05H12.2 protein.
          Length = 329

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = -3

Query: 475 PFSHHDRLGFLTFCPTNLGTTVRASVH 395
           P  H DRL  LTFC  +  T V   +H
Sbjct: 194 PVRHRDRLALLTFCDIDTQTIVLWRIH 220


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,280,363
Number of Sequences: 27780
Number of extensions: 205459
Number of successful extensions: 758
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 718
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 752
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1756472266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).