SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80836-7|AAB37893.3|  451|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z66521-13|CAA91403.1|  444|Caenorhabditis elegans Hypothetical p...    29   5.5  
AL023847-2|CAA19546.1|  359|Caenorhabditis elegans Hypothetical ...    29   5.5  
Z81508-4|CAB04139.1|  371|Caenorhabditis elegans Hypothetical pr...    28   9.7  

>U80836-7|AAB37893.3|  451|Caenorhabditis elegans Hypothetical
           protein B0432.13 protein.
          Length = 451

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = +2

Query: 95  LCSWQRRMPRTPECPMST--SDLVVKMFFFIA*MGGRAHSPPGVKWLPEAHR 244
           +  W     + P C  +   +  V K+FF +  MGG A  PP + +  E ++
Sbjct: 40  ISQWIATKRQCPSCRRTVPKNGFVEKLFFDVQRMGGEAEKPPEIDYREEHYK 91


>Z66521-13|CAA91403.1|  444|Caenorhabditis elegans Hypothetical
           protein W02B12.8a protein.
          Length = 444

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +2

Query: 191 GGRAHSPPGVKWLPEAHRHLQRKCATHLE 277
           G R+H+ P V+WL +A++ L R+   +L+
Sbjct: 138 GLRSHNKPPVRWLFQAYKQLDRRFKKNLK 166


>AL023847-2|CAA19546.1|  359|Caenorhabditis elegans Hypothetical
           protein Y57A10C.4 protein.
          Length = 359

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -1

Query: 765 RLIFVIKGTFYLLLASTVRCF*LNFN*VYSCQIAEEVLFCYDIFSKCSTLNGSP 604
           RL+FV+  T  ++    V    L    ++     E  LFCY ++     +NG P
Sbjct: 255 RLVFVVLATIVVMGFGIVALV-LEITVLFFMHFGENTLFCYPLYIFLVVMNGHP 307


>Z81508-4|CAB04139.1|  371|Caenorhabditis elegans Hypothetical
           protein F20E11.6 protein.
          Length = 371

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 19/46 (41%), Positives = 26/46 (56%)
 Frame = -3

Query: 598 ITKMLFKPNSLSSSIFKHD*FFKKCFIGCLLRLIVYSGYTSFFFPE 461
           ITK+    +SLSSS+F +  F     +  L  LI YS Y++FF  E
Sbjct: 121 ITKLRGSADSLSSSVFGYIVFI---LLLILHSLISYSFYSTFFLRE 163


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,456,481
Number of Sequences: 27780
Number of extensions: 423653
Number of successful extensions: 840
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 840
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2118983636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).