SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41530-1|AAA83273.3|  636|Caenorhabditis elegans Hypothetical pr...    32   0.27 
DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-t...    31   0.63 
AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-t...    31   0.63 
AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel...    31   0.63 
AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel...    31   0.63 
AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel...    31   0.63 
U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symme...    29   2.6  
U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel t...    29   2.6  
DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-t...    29   2.6  
AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-t...    29   2.6  
AC006701-4|AAK68403.2|  606|Caenorhabditis elegans Hypothetical ...    27   7.8  

>U41530-1|AAA83273.3|  636|Caenorhabditis elegans Hypothetical
           protein SSSD1.1 protein.
          Length = 636

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 342 SYGAMIEGLGSGGACIGATRSRRACTASHVPDPI 241
           SY   IE + + G+    T +RR+CT+ H PD +
Sbjct: 370 SYRVSIESVNAKGSTNSTTYNRRSCTSLHAPDKL 403


>DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-type
            voltage-gatedion channel alpha-1 subunit protein.
          Length = 1797

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+PS S
Sbjct: 1149 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1182


>AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-type
            voltage-gatedion channel alpha-1 subunit protein.
          Length = 1831

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+PS S
Sbjct: 1183 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1216


>AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel
            type/putative nematodecalcium channel protein 1, isoform
            a protein.
          Length = 1562

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+PS S
Sbjct: 1241 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1274


>AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel
            type/putative nematodecalcium channel protein 1, isoform
            c protein.
          Length = 1913

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+PS S
Sbjct: 1294 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1327


>AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel
            type/putative nematodecalcium channel protein 1, isoform
            d protein.
          Length = 1861

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+PS S
Sbjct: 1213 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1246


>U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symmetry
           protein 1 protein.
          Length = 1425

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +2

Query: 188 DEMSRFEAEISGGTGRAVIGSGTWDAVQA 274
           +E  RFE E+S    R V+G GT+  V A
Sbjct: 652 NEKIRFEYELSNSNERVVLGKGTYGTVYA 680


>U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel
            type/putative nematodecalcium channel protein 2 protein.
          Length = 1785

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+P  S
Sbjct: 1205 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1238


>DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-type
            voltage-gatedion channel alpha-1 subunit protein.
          Length = 1763

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+P  S
Sbjct: 1183 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1216


>AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-type
            voltage-gatedion channel alpha-1 subunit protein.
          Length = 1785

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 224  GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325
            GT    +    W  ++ARL+   P+  PP+P  S
Sbjct: 1205 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1238


>AC006701-4|AAK68403.2|  606|Caenorhabditis elegans Hypothetical
           protein Y104H12D.3 protein.
          Length = 606

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +1

Query: 223 RHWTCSDRIWHMGCRASPSRTGGSNAGPTRT 315
           RH   ++  W  GC A+P+ +GG + G   T
Sbjct: 368 RHQFFTNSEWPGGCYATPTMSGGRDGGAVAT 398


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,207,216
Number of Sequences: 27780
Number of extensions: 239996
Number of successful extensions: 805
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 781
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 805
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1289949676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).