SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   497   e-141
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   497   e-141
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       497   e-141
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       497   e-141
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       497   e-141
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   497   e-141
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   496   e-141
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       494   e-140
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   473   e-134
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   458   e-129
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   404   e-113
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   285   2e-77
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   256   1e-68
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...   190   1e-48
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   186   1e-47
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   186   1e-47
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   185   3e-47
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   180   1e-45
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...   128   6e-30
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    82   5e-16
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    82   5e-16
U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical pr...    67   2e-11
U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical pr...    36   0.025
U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical pr...    36   0.025
U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical pr...    36   0.025
Z70208-2|CAA94136.1|  304|Caenorhabditis elegans Hypothetical pr...    36   0.033
Z99773-3|CAE11316.1|  305|Caenorhabditis elegans Hypothetical pr...    34   0.10 
U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical pr...    34   0.13 
U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical pr...    34   0.13 
AC024805-15|AAK39331.2|  344|Caenorhabditis elegans Hypothetical...    34   0.13 
Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical pr...    33   0.23 
Z70287-6|CAH04747.1|  443|Caenorhabditis elegans Hypothetical pr...    33   0.23 
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    33   0.23 
U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical pr...    32   0.41 
Z69658-1|CAA93481.1|  418|Caenorhabditis elegans Hypothetical pr...    32   0.54 
Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical pr...    31   0.71 
U97193-7|AAK68163.1|  299|Caenorhabditis elegans Yeast sir relat...    31   0.94 
AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin (droso...    31   0.94 
AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin (droso...    31   0.94 
AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin (droso...    31   0.94 
AC006630-3|AAK68325.1|  257|Caenorhabditis elegans Hypothetical ...    31   0.94 
Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical pr...    30   1.6  
U64835-5|AAG24196.1|  592|Caenorhabditis elegans Hypothetical pr...    30   1.6  
Z34802-8|CAH10787.1|  704|Caenorhabditis elegans Hypothetical pr...    30   2.2  
Z34802-7|CAA84338.2|  828|Caenorhabditis elegans Hypothetical pr...    30   2.2  
U41278-7|AAT81193.1|  680|Caenorhabditis elegans Hypothetical pr...    30   2.2  
U41278-6|AAK31510.3|  771|Caenorhabditis elegans Hypothetical pr...    30   2.2  
Z77666-12|CAJ43911.2|  896|Caenorhabditis elegans Hypothetical p...    29   2.9  
Z77666-9|CAJ43912.1|  541|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z77666-8|CAJ43910.1|  493|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z77666-7|CAB01228.1| 1221|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z77658-2|CAB01156.1|  457|Caenorhabditis elegans Hypothetical pr...    29   2.9  
U97015-9|AAB52349.1|  343|Caenorhabditis elegans Hypothetical pr...    29   2.9  
U50197-2|AAA91255.2|  624|Caenorhabditis elegans Hypothetical pr...    29   2.9  
U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (gr...    29   2.9  
AF016448-12|AAB65959.1|  316|Caenorhabditis elegans Hypothetical...    29   2.9  
AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical ...    29   2.9  
Z75539-1|CAA99843.1|  672|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z68317-3|CAA92687.1|  599|Caenorhabditis elegans Hypothetical pr...    29   5.0  
U58757-9|AAM75377.1|  503|Caenorhabditis elegans Hypothetical pr...    29   5.0  
U58757-8|AAC47918.3|  506|Caenorhabditis elegans Hypothetical pr...    29   5.0  
AF125964-1|AAD14753.1|  471|Caenorhabditis elegans Hypothetical ...    29   5.0  
AF039044-7|AAG24125.1|  125|Caenorhabditis elegans Hypothetical ...    29   5.0  
AC024794-1|AAK68497.1|  994|Caenorhabditis elegans Hypothetical ...    29   5.0  
U28738-11|AAK68399.3|  166|Caenorhabditis elegans Sr protein (sp...    28   6.6  
U28738-10|AAK72066.3|  208|Caenorhabditis elegans Sr protein (sp...    28   6.6  
U28738-9|AAA68314.3|  208|Caenorhabditis elegans Sr protein (spl...    28   6.6  
U25032-1|AAB18670.1| 1379|Caenorhabditis elegans par-3 protein.        28   6.6  
U00067-5|ABD63219.1| 1340|Caenorhabditis elegans Abnormal embryo...    28   6.6  
U00067-4|AAK73874.1| 1376|Caenorhabditis elegans Abnormal embryo...    28   6.6  
U00067-3|AAK73875.1| 1379|Caenorhabditis elegans Abnormal embryo...    28   6.6  
AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical ...    28   6.6  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    28   6.6  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    28   6.6  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    28   6.6  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    28   6.6  
Z81461-6|CAB03837.1|  272|Caenorhabditis elegans Hypothetical pr...    28   8.8  
Z69360-4|CAC42291.2|  732|Caenorhabditis elegans Hypothetical pr...    28   8.8  
Z69360-3|CAA93286.2|  369|Caenorhabditis elegans Hypothetical pr...    28   8.8  
Z69360-2|CAA93285.2|  780|Caenorhabditis elegans Hypothetical pr...    28   8.8  
U64857-15|AAC25858.1|  470|Caenorhabditis elegans Hypothetical p...    28   8.8  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   8.8  
AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ...    28   8.8  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  497 bits (1225), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  496 bits (1223), Expect = e-141
 Identities = 234/237 (98%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  494 bits (1219), Expect = e-140
 Identities = 232/237 (97%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  473 bits (1166), Expect = e-134
 Identities = 221/235 (94%), Positives = 230/235 (97%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK+NREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYV IQAVLSLYASGRTTGIVLD+GDGV+HTVPIYEGYALPHAI RLDLA
Sbjct: 122 IMFETFNTPAMYVNIQAVLSLYASGRTTGIVLDTGDGVTHTVPIYEGYALPHAIQRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDY+MKILTERGY+FTTTAEREIVRDIKEKLCYVA DFE E+A AASSSSL
Sbjct: 182 GRDLTDYMMKILTERGYTFTTTAEREIVRDIKEKLCYVAHDFESELAAAASSSSL 236


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  458 bits (1129), Expect = e-129
 Identities = 216/219 (98%), Positives = 219/219 (100%)
 Frame = +1

Query: 130 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 309
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 64

Query: 310 NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 489
           NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ
Sbjct: 65  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 124

Query: 490 AVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
           AVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 125 AVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 184

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 185 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 223


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  404 bits (994), Expect = e-113
 Identities = 191/193 (98%), Positives = 193/193 (100%)
 Frame = +1

Query: 208 MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
           MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 60

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTV 567
           LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTV
Sbjct: 61  LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTV 120

Query: 568 PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF 747
           PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF
Sbjct: 121 PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF 180

Query: 748 EQEMATAASSSSL 786
           EQEMATAASSSSL
Sbjct: 181 EQEMATAASSSSL 193


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  285 bits (699), Expect = 2e-77
 Identities = 126/216 (58%), Positives = 168/216 (77%), Gaps = 1/216 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G +A+S RG+ ++
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAESNRGLFSI 70

Query: 280 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+APLNP  NRE+  +I FET
Sbjct: 71  EYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRERSAEIFFET 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+Y+ +QAVLSLYA+GRTTG+VLDSGDGV+H VPI +G+A+ HAI R+DLAGRD+T
Sbjct: 131 FNVPALYIQMQAVLSLYATGRTTGVVLDSGDGVTHAVPIVKGFAMKHAIQRMDLAGRDVT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           +YL  +L   GY F  + E EIVR++KE  CY+ALD
Sbjct: 191 EYLRVLLRREGYEFHRSNEFEIVREMKENACYLALD 226


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  256 bits (627), Expect = 1e-68
 Identities = 123/232 (53%), Positives = 165/232 (71%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM-VGMGQ-KDSYVGDEAQSKRGIL 273
           +VVDNG+G  K G+AG + P  +FPS+VGRP  +    VG  + KD  VG+E    R +L
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEECSQLRQML 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+++GIV NWDDM  +W HTF  E L + P+E  +LLTE PLNP +NREKM Q+MF
Sbjct: 69  DINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPLNPNSNREKMFQVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           E +   ++YVA+QAVL+LYA G  TG+V+DSGDGV+H  P+YEG+AL H   RLD+AGRD
Sbjct: 129 EQYGFNSIYVAVQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFALHHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L +RGY+F  +A+ E VR +KEKLCY+A D EQE   A  ++ L
Sbjct: 189 ITKYLIKLLLQRGYNFNHSADFETVRQMKEKLCYIAYDVEQEERLALETTVL 240


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score =  190 bits (462), Expect = 1e-48
 Identities = 100/248 (40%), Positives = 142/248 (57%), Gaps = 21/248 (8%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI------VGRPRHQG------VMVGM 219
           M   ++ A V+DNG+G  K G+AG+  P+ + PS       V     Q       V  G+
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAIAVKDKVASSNSQAMRWNNRVGAGI 60

Query: 220 GQKDSYVGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 396
              D ++GDEA S      T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLT
Sbjct: 61  DDLDFFIGDEALSPAATNYTVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLT 120

Query: 397 EAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDG 552
           E PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG+V+DSGDG
Sbjct: 121 EPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALTASWNSREANERSLTGLVIDSGDG 180

Query: 553 VSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY 732
           V+H +P+ +GY +   I  + +AGRD+T ++  +L +R ++       E+ + IKEK CY
Sbjct: 181 VTHCIPVADGYVIGSCIKHIPIAGRDITYFIQSLLRDREHTIPAEQSYEVAKMIKEKFCY 240

Query: 733 VALDFEQE 756
           V  D  +E
Sbjct: 241 VCPDVMKE 248


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  186 bits (454), Expect = 1e-47
 Identities = 85/86 (98%), Positives = 86/86 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKI 333
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  186 bits (454), Expect = 1e-47
 Identities = 85/86 (98%), Positives = 86/86 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKI 333
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  185 bits (451), Expect = 3e-47
 Identities = 84/86 (97%), Positives = 86/86 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKI 333
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  180 bits (437), Expect = 1e-45
 Identities = 81/83 (97%), Positives = 83/83 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDM 324
           SKRGILTLKYPIEHGIVTNWDDM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDM 83


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score =  128 bits (308), Expect = 6e-30
 Identities = 73/211 (34%), Positives = 118/211 (55%), Gaps = 17/211 (8%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA--QS 258
           +EV+ LV D GS   + GFAG++ P+   PS +             Q+    GD +  Q+
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYIAVQEALPDDTIEKQEAMEEGDNSKVQT 68

Query: 259 KR------GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 393
           KR      G   +  P         ++ G++ +W+  EKI  H++ N L   P EHPVL 
Sbjct: 69  KREKNFFIGTTKIIVPRARTNMESFMKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLF 128

Query: 394 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 573
           +E+  N +A REK+T+IMFE F  PA Y++   VLS +A GRT G+++DSG   +  VP+
Sbjct: 129 SESSWNDRARREKLTEIMFEKFQVPAYYLSKNVVLSCFAQGRTHGLMVDSGATQTSVVPV 188

Query: 574 YEGYALPHAILRLDLAGRDLTDYLMKILTER 666
           ++GYA+ HA+++  + G  +T+ L ++L ++
Sbjct: 189 FDGYAVTHAVVKCPIGGDLITEQLAQMLDQQ 219


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 81.8 bits (193), Expect = 5e-16
 Identities = 57/230 (24%), Positives = 107/230 (46%), Gaps = 4/230 (1%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 270
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     +E   K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQ----EECSDKFSL 57

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
             ++ PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILF 115

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTT----GIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           + F    ++    + L    S +       +V+DSG   +       G  +  +++R+D+
Sbjct: 116 DYFGFTEVHKTSASTLVAKHSNKINNEKCAVVVDSGFSWTTVASFVNGMLIQDSVIRIDV 175

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
            G+ LT+ L   ++ R      + E  ++ + KE LC+V+ +F++ M  A
Sbjct: 176 GGKALTNKLKDWVSYR--QLNVSEETYVINECKEDLCFVSQNFDESMKEA 223


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 81.8 bits (193), Expect = 5e-16
 Identities = 57/230 (24%), Positives = 107/230 (46%), Gaps = 4/230 (1%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 270
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     +E   K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQ----EECSDKFSL 57

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
             ++ PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILF 115

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTT----GIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           + F    ++    + L    S +       +V+DSG   +       G  +  +++R+D+
Sbjct: 116 DYFGFTEVHKTSASTLVAKHSNKINNEKCAVVVDSGFSWTTVASFVNGMLIQDSVIRIDV 175

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
            G+ LT+ L   ++ R      + E  ++ + KE LC+V+ +F++ M  A
Sbjct: 176 GGKALTNKLKDWVSYR--QLNVSEETYVINECKEDLCFVSQNFDESMKEA 223


>U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical
           protein F42C5.9 protein.
          Length = 552

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 59/224 (26%), Positives = 99/224 (44%), Gaps = 5/224 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDA--PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           L+++ GS   +AG    +   P++ FP+I  R     + VG       +       R I 
Sbjct: 181 LILELGSCSIRAGVLTTEPSLPQSFFPAIAVRTDDGKIFVGEDAYRPEIRHNGDFVRPIS 240

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
                +E   +    D+ K        EL+V P ++ VLL+     P     ++ QI  E
Sbjct: 241 ATDPSVERYSIDK--DVLKAVIGKVTKELKVEPWKYKVLLSIPQNIPTVLIGELLQICLE 298

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
                +  +  Q  L LYA   TTG+V+D G+ V + VP+ +GY +  AI  +    + +
Sbjct: 299 DIKFQSAGITRQPSLILYAYDVTTGVVVDIGERV-NIVPVIDGYVVESAICSIPYGSQQM 357

Query: 634 TDYLMKILTERG---YSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            D L   L+      Y+F +  E+ I+R   E+  YV  D+++E
Sbjct: 358 GDSLRASLSAHNKGLYAFQSPVEKLILRFALEQTTYVPEDYQKE 401


>U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical
           protein C12D12.1a protein.
          Length = 769

 Score = 36.3 bits (80), Expect = 0.025
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
           ST  P T+P  P S  T P VPPV+  TP T + T   +T  T
Sbjct: 659 STTAP-TAPVNPTSPTTAPTVPPVTTTTPTTTTSTTTTTTTTT 700



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 3/59 (5%)
 Frame = +2

Query: 449 SKHSTRPPCT---SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +K  T PP T   SP+ P +  T P   PV+  +  T    P   T  T +PT   V T
Sbjct: 626 TKLPTSPPSTVGTSPTAPAN-LTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPTVPPVTT 683


>U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical
           protein C12D12.1c protein.
          Length = 825

 Score = 36.3 bits (80), Expect = 0.025
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
           ST  P T+P  P S  T P VPPV+  TP T + T   +T  T
Sbjct: 715 STTAP-TAPVNPTSPTTAPTVPPVTTTTPTTTTSTTTTTTTTT 756



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 3/59 (5%)
 Frame = +2

Query: 449 SKHSTRPPCT---SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +K  T PP T   SP+ P +  T P   PV+  +  T    P   T  T +PT   V T
Sbjct: 682 TKLPTSPPSTVGTSPTAPAN-LTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPTVPPVTT 739


>U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical
           protein C12D12.1b protein.
          Length = 648

 Score = 36.3 bits (80), Expect = 0.025
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
           ST  P T+P  P S  T P VPPV+  TP T + T   +T  T
Sbjct: 538 STTAP-TAPVNPTSPTTAPTVPPVTTTTPTTTTSTTTTTTTTT 579


>Z70208-2|CAA94136.1|  304|Caenorhabditis elegans Hypothetical
           protein F54B11.2 protein.
          Length = 304

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 29/83 (34%), Positives = 33/83 (39%)
 Frame = +3

Query: 171 PLDRGKAPPSGRDGRYGTEGLLCRR*GTEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLL 350
           P   G A P+G DG  GT G         +  YP+P  P         G  G D AS   
Sbjct: 189 PGPSGPAGPAGNDGAAGTPG---PDGPAGESTYPEPAAPGPAGPPGPAGPPGPDGASPTA 245

Query: 351 Q*AACRPRGTPSPAH*GSPQPQG 419
              A  P G P PA  G+P P G
Sbjct: 246 APGAAGPPGPPGPA--GAPGPDG 266


>Z99773-3|CAE11316.1|  305|Caenorhabditis elegans Hypothetical
           protein H06A10.2 protein.
          Length = 305

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 28/79 (35%), Positives = 32/79 (40%)
 Frame = +3

Query: 183 GKAPPSGRDGRYGTEGLLCRR*GTEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AA 362
           G A P+G DG  GT G         +  YP+P  P         G  G D AS      A
Sbjct: 194 GPAGPAGNDGAAGTPG---PDGPAGESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGA 250

Query: 363 CRPRGTPSPAH*GSPQPQG 419
             P G P PA  G+P P G
Sbjct: 251 AGPPGPPGPA--GAPGPDG 267


>U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical
           protein F49E10.2a protein.
          Length = 790

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 5/54 (9%)
 Frame = +2

Query: 452 KHSTRPPCTSPS-----KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           K ST PP TS S     KP +  T P   P S  T  T +P P  ST  + S T
Sbjct: 579 KVSTVPPTTSTSSTTTQKPSTTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTT 632


>U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical
           protein F49E10.2b protein.
          Length = 842

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 5/54 (9%)
 Frame = +2

Query: 452 KHSTRPPCTSPS-----KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           K ST PP TS S     KP +  T P   P S  T  T +P P  ST  + S T
Sbjct: 579 KVSTVPPTTSTSSTTTQKPSTTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTT 632


>AC024805-15|AAK39331.2|  344|Caenorhabditis elegans Hypothetical
           protein Y51H7C.13 protein.
          Length = 344

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           TSP  P  +   P +PP +  T  T +  PCP    T++P
Sbjct: 122 TSPPAPVDQKPPPCIPPTTTTTTTTTTRPPCPYPPATNTP 161


>Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical
           protein C30H6.11 protein.
          Length = 460

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           +T  P T+ + P +  T     P +  T  T +PT   +T  T + TP+   T P
Sbjct: 121 TTTTPTTTTTTPTTTTTETTTTPTTTTTETTTTPTTTTTTPTTTTTTPTTTTTTP 175



 Score = 31.5 bits (68), Expect = 0.71
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +T    T+ + P +  T    P  +  TP T + TP  +T+ T +PT     T
Sbjct: 67  TTTTSTTTTTTPTTPTTTTTTPTTTTTTPTTTTTTPTTTTETTTTPTTETTTT 119



 Score = 31.5 bits (68), Expect = 0.71
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T  P T+ + P +  T    P  +  TP T + TP  +T +T + TP+
Sbjct: 213 TTTVPTTTTTTPTTTTTTTTTPTTTTTTPTTTT-TPATTTSETTTTTPT 260



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           +T  P T+ + P +  T P     +  T  T +PT   +T  T + TP+   T P
Sbjct: 164 TTTTPTTTTTTPTTTTTTPTTTTTTP-TTTTTAPTTTTTTPTTTTTTPTTTTTVP 217



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 4/51 (7%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVV----PPVSCWTPATVSPTPCPSTKDTHSPT 598
           +T  P T+ + P +  T P      P  +   P T + TP  +T  T +PT
Sbjct: 185 TTTTPTTTTTAPTTTTTTPTTTTTTPTTTTTVPTTTTTTPTTTTTTTTTPT 235



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPV----VPPVSCWTPATVSPTPCPSTKDTHSPT 598
           +T  P T+ + P +  T P     VP  +  TP T + T    T  T +PT
Sbjct: 192 TTTAPTTTTTTPTTTTTTPTTTTTVPTTTTTTPTTTTTTTTTPTTTTTTPT 242


>Z70287-6|CAH04747.1|  443|Caenorhabditis elegans Hypothetical
           protein R09E10.9 protein.
          Length = 443

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWT--PATVSPTPCPSTKDTHSPTPSC 607
           P    P+ P      P VPP    T  P TVS  P PS      PT SC
Sbjct: 355 PSKVVPNPPQKSLITPTVPPSMIQTVNPPTVSALPSPSVSPAPVPTTSC 403


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 1/109 (0%)
 Frame = -1

Query: 404 GASVSRTGCSSGATRSSL*KV*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCASSPT*ESF 225
           GA  S  G SS    S+       I   + ++ T+  S        PL++ +SS    S 
Sbjct: 424 GAPSSTLGSSSSTIVSTT------ITPSTPKVSTLTLSQSPTPTSTPLVVSSSSSGSSST 477

Query: 224 CPIPTITP*WRGLPTIEGN-TARGASSPAKPALHIPEPLSTTNAATSSS 81
               TITP  +G+PT   N      S+P  P   +    STT A +++S
Sbjct: 478 VVTSTITPSTQGVPTSTSNQPTPSTSNPTTPKSTVTASPSTTGATSTAS 526


>U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical
           protein C01G8.9a protein.
          Length = 1724

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -1

Query: 554 TPSPESSTIPVVRPDAYSESTAWMATYMAGVL 459
           TP P SST+PVV P   ++ T    +Y+A  L
Sbjct: 865 TPQPLSSTMPVVAPSTSTQPTPTTGSYLANTL 896


>Z69658-1|CAA93481.1|  418|Caenorhabditis elegans Hypothetical
           protein C36H8.1 protein.
          Length = 418

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           RPP   P KP  +   P  PP     P   +P P P+  +  +P P+ V
Sbjct: 181 RPPPQEPPKPVEQAAPPP-PPAPMPVPVEKAPEPVPAPVEQIAPPPAPV 228


>Z83227-3|CAB05726.2|  241|Caenorhabditis elegans Hypothetical
           protein F45B8.3 protein.
          Length = 241

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 2/56 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC--PSTKDTHSPTPSC 607
           C  +    P   P  P S C  P   P  C  P      PC  P    T SP   C
Sbjct: 80  CCPYVPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPTPSPLVCC 135



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%)
 Frame = +2

Query: 470 PCTSPSK-PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PC  PS  P   C  P  P   C  P    PTP P      +P P
Sbjct: 98  PCCGPSPVPAPCCPPPPAPAAPCCPPPP-PPTPSPLVCCKQAPVP 141



 Score = 28.7 bits (61), Expect = 5.0
 Identities = 22/88 (25%), Positives = 25/88 (28%), Gaps = 6/88 (6%)
 Frame = +2

Query: 356 SCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPP--CTSPSKPCSRCTRPVVPPV 529
           +C   PR + SC                  C   S  P   C  P  P + C  P  PP 
Sbjct: 69  NCCGAPRPSPSCCPYVPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPT 128

Query: 530 S----CWTPATVSPTPCPSTKDTHSPTP 601
                C   A V   PC        P P
Sbjct: 129 PSPLVCCKQAPVPENPCCQIVAAAMPPP 156


>U97193-7|AAK68163.1|  299|Caenorhabditis elegans Yeast sir related
           protein 2.4 protein.
          Length = 299

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 3/114 (2%)
 Frame = +1

Query: 241 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 420
           G   + K    TL +  E  +  + D + K W  T +  L +      + +   PL+ K+
Sbjct: 183 GRSCRGKLRDATLDWDTEISL-NHLDRIRKAWKQTSHL-LCIGTSLEIIPMGSLPLDAKS 240

Query: 421 NREKMTQIMF-ETFNTPAMYVAIQA--VLSLYASGRTTGIVLDSGDGVSHTVPI 573
              K T I + ET +   +  AI A   L LY+     G+ +D GD +   VPI
Sbjct: 241 KGIKTTTINYQETAHEKIVETAIHADVKLILYSLCNALGVNVDLGDDLPDEVPI 294


>AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform a
           protein.
          Length = 4488

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 2/74 (2%)
 Frame = +3

Query: 423 QREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGL--RRRCLPHRAHLRRIRTPP 596
           +RE   +  R ++H + +R+   + L  R +S    RA L   RR L H  HLR+ +   
Sbjct: 57  ERERLEEERRQLEHEKRLRQQQQQQLFEREKSEKEERARLEEERRRLEHEKHLRQQQQTQ 116

Query: 597 RHPASGLSRSRPHR 638
            +        +PH+
Sbjct: 117 PYNLHYQQHHQPHQ 130


>AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform d
           protein.
          Length = 4369

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 2/74 (2%)
 Frame = +3

Query: 423 QREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGL--RRRCLPHRAHLRRIRTPP 596
           +RE   +  R ++H + +R+   + L  R +S    RA L   RR L H  HLR+ +   
Sbjct: 57  ERERLEEERRQLEHEKRLRQQQQQQLFEREKSEKEERARLEEERRRLEHEKHLRQQQQTQ 116

Query: 597 RHPASGLSRSRPHR 638
            +        +PH+
Sbjct: 117 PYNLHYQQHHQPHQ 130


>AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform c
           protein.
          Length = 4447

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 2/74 (2%)
 Frame = +3

Query: 423 QREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGL--RRRCLPHRAHLRRIRTPP 596
           +RE   +  R ++H + +R+   + L  R +S    RA L   RR L H  HLR+ +   
Sbjct: 57  ERERLEEERRQLEHEKRLRQQQQQQLFEREKSEKEERARLEEERRRLEHEKHLRQQQQTQ 116

Query: 597 RHPASGLSRSRPHR 638
            +        +PH+
Sbjct: 117 PYNLHYQQHHQPHQ 130


>AC006630-3|AAK68325.1|  257|Caenorhabditis elegans Hypothetical
           protein F14H12.3 protein.
          Length = 257

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +2

Query: 470 PCTSPSK-PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           PC   +  PC+ C +P  P  +C T   V  TP P T  T    P+C
Sbjct: 182 PCPQQAACPCTTCNQPPPPCNTCNTQPVVIVTPAPCT--TCYQPPAC 226


>Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical
           protein F28D9.1 protein.
          Length = 601

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 30/95 (31%), Positives = 38/95 (40%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR   SP+   SP P+   R   P   ++ Q  R  RR PS + +   R      A  RR
Sbjct: 437 PRRRRSPSQSKSPAPR---RRRSPS--KSPQAPRR-RRSPSGSKSRSPRRRRSPAAAPRR 490

Query: 549 RCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHED 653
           R  P R    R R  P   +   S   P R P +D
Sbjct: 491 RQSPQRRRSPRRRRSPSSSSRSRSPPPPPRRPRQD 525



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 28/88 (31%), Positives = 36/88 (40%), Gaps = 3/88 (3%)
 Frame = +3

Query: 378 TPSPAH*GSPQ--PQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVR-SYHRYRAGLRR 548
           +P+P    SP   PQ  +R   P   ++    R  RR  S A A R R S  R R+  RR
Sbjct: 448 SPAPRRRRSPSKSPQAPRRRRSPSGSKS----RSPRRRRSPAAAPRRRQSPQRRRSPRRR 503

Query: 549 RCLPHRAHLRRIRTPPRHPASGLSRSRP 632
           R     +  R    PPR P     +  P
Sbjct: 504 RSPSSSSRSRSPPPPPRRPRQDSEQQAP 531


>U64835-5|AAG24196.1|  592|Caenorhabditis elegans Hypothetical
           protein T09D3.3 protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 17/53 (32%), Positives = 24/53 (45%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +T  PC + +   +  T  +VP  S  T  T + TP P T  T  PT +   T
Sbjct: 440 TTPVPCPTTTSTTTSATT-LVPTTSSSTTTTTTTTPVPVTSTTTEPTTTTYTT 491


>Z34802-8|CAH10787.1|  704|Caenorhabditis elegans Hypothetical
           protein M88.5b protein.
          Length = 704

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 17/79 (21%), Positives = 31/79 (39%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           QPQ  Q+       +  Q   H ++HP        + YH ++   + +   H+    + +
Sbjct: 96  QPQQMQQAQQQQAQQMHQMQIHHQQHPQMMQQHAQQGYHPHQQNQQHQAGQHQQSHHQSQ 155

Query: 588 TPPRHPASGLSRSRPHRLP 644
              +H     S S PH +P
Sbjct: 156 NHNQHRNHNQSHSGPHHIP 174


>Z34802-7|CAA84338.2|  828|Caenorhabditis elegans Hypothetical
           protein M88.5a protein.
          Length = 828

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 17/79 (21%), Positives = 31/79 (39%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           QPQ  Q+       +  Q   H ++HP        + YH ++   + +   H+    + +
Sbjct: 220 QPQQMQQAQQQQAQQMHQMQIHHQQHPQMMQQHAQQGYHPHQQNQQHQAGQHQQSHHQSQ 279

Query: 588 TPPRHPASGLSRSRPHRLP 644
              +H     S S PH +P
Sbjct: 280 NHNQHRNHNQSHSGPHHIP 298


>U41278-7|AAT81193.1|  680|Caenorhabditis elegans Hypothetical
           protein F33G12.6b protein.
          Length = 680

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = -2

Query: 262 FCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEH-HLLRNRPCTYRSHCL 107
           FC +    H++    + P R D      +RG  +++H    RNRPC     C+
Sbjct: 393 FCVIKKSEHENKENAHLPPREDRTLDVTTRGGEKDKHSEYARNRPCAASLPCV 445


>U41278-6|AAK31510.3|  771|Caenorhabditis elegans Hypothetical
           protein F33G12.6a protein.
          Length = 771

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = -2

Query: 262 FCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEH-HLLRNRPCTYRSHCL 107
           FC +    H++    + P R D      +RG  +++H    RNRPC     C+
Sbjct: 393 FCVIKKSEHENKENAHLPPREDRTLDVTTRGGEKDKHSEYARNRPCAASLPCV 445


>Z77666-12|CAJ43911.2|  896|Caenorhabditis elegans Hypothetical
           protein K08E7.5c protein.
          Length = 896

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/45 (31%), Positives = 18/45 (40%)
 Frame = +2

Query: 473 CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           C +P  PC   T P  PP+ C     +   P P       P P+C
Sbjct: 645 CCAPPAPCCLPTIPCCPPIPCCPQPKICCQPAP----VCLPPPTC 685


>Z77666-9|CAJ43912.1|  541|Caenorhabditis elegans Hypothetical
           protein K08E7.5d protein.
          Length = 541

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/45 (31%), Positives = 18/45 (40%)
 Frame = +2

Query: 473 CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           C +P  PC   T P  PP+ C     +   P P       P P+C
Sbjct: 290 CCAPPAPCCLPTIPCCPPIPCCPQPKICCQPAP----VCLPPPTC 330


>Z77666-8|CAJ43910.1|  493|Caenorhabditis elegans Hypothetical
           protein K08E7.5b protein.
          Length = 493

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/45 (31%), Positives = 18/45 (40%)
 Frame = +2

Query: 473 CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           C +P  PC   T P  PP+ C     +   P P       P P+C
Sbjct: 242 CCAPPAPCCLPTIPCCPPIPCCPQPKICCQPAP----VCLPPPTC 282


>Z77666-7|CAB01228.1| 1221|Caenorhabditis elegans Hypothetical protein
            K08E7.5a protein.
          Length = 1221

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/45 (31%), Positives = 18/45 (40%)
 Frame = +2

Query: 473  CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
            C +P  PC   T P  PP+ C     +   P P       P P+C
Sbjct: 970  CCAPPAPCCLPTIPCCPPIPCCPQPKICCQPAP----VCLPPPTC 1010


>Z77658-2|CAB01156.1|  457|Caenorhabditis elegans Hypothetical
           protein F14D7.2 protein.
          Length = 457

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP 565
           ST+PP T  ++      RP +PP+      T SPTP
Sbjct: 109 STKPPVTCRTEFTELEARPAIPPLGNLEGLTDSPTP 144


>U97015-9|AAB52349.1|  343|Caenorhabditis elegans Hypothetical
           protein F48C1.8 protein.
          Length = 343

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/41 (36%), Positives = 16/41 (39%)
 Frame = -3

Query: 588 CVSFVDGHGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHGG 466
           C +   GH  G    G  H  GG  G     HG  G  HGG
Sbjct: 169 CEAHGGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHGG 209


>U50197-2|AAA91255.2|  624|Caenorhabditis elegans Hypothetical
           protein F25E2.2 protein.
          Length = 624

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVP-PVSCWTPATVSPTPCPSTKDTHS-PT 598
           +T    T+  KP +  T    P P +   P T + TP P+T  T S PT
Sbjct: 420 TTTTTTTTTPKPTTTTTTTTTPAPTTTQKPTTTTTTPAPTTTSTTSIPT 468


>U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (grd
           related) protein 4 protein.
          Length = 210

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/45 (33%), Positives = 16/45 (35%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P C  P  PC     P+ PP  C  P    P P P       P P
Sbjct: 36  PMCAPPPLPCP--PPPICPPQFCPPPPMCPPPPPPPPPPMCPPPP 78



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%)
 Frame = +2

Query: 467 PPCTSPSKP-CSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           PPC  P  P C+    P  PP  C  P    P P         P P C
Sbjct: 28  PPCPPPPPPMCAPPPLPCPPPPIC-PPQFCPPPPMCPPPPPPPPPPMC 74


>AF016448-12|AAB65959.1|  316|Caenorhabditis elegans Hypothetical
           protein F41E6.11 protein.
          Length = 316

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/59 (27%), Positives = 21/59 (35%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*PV 625
           S +   PPC  P   C+    P  PP     P    P P P+        P C+   P+
Sbjct: 21  SLNCATPPCPEPMPVCAT---PPCPPQYAPLPPPPMPAPAPAYNPYPCANPPCIVVEPM 76


>AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical
           protein Y51B11A.1 protein.
          Length = 1079

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = +2

Query: 458 STRPPCTSPSK-PCSRCTRPVV----PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           ST PP +S +    +  T P      PP S  TP   + T  P T  T SP+ S
Sbjct: 200 STEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTTTAPETTSTESPSSS 253



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = +2

Query: 458 STRPPCTSPSK-PCSRCTRPVV----PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           ST PP +S +    +  T P      PP S  TP   + T  P T  T SP+ S
Sbjct: 476 STEPPSSSTTPVQTTTITAPETTSTEPPSSSTTPVQTTTTTAPETTSTESPSSS 529



 Score = 28.7 bits (61), Expect = 5.0
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 5/54 (9%)
 Frame = +2

Query: 458 STRPPCTSPSK-PCSRCTRPVV----PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           ST PP +S S    +  T P      PP S  TP   + T  P T  T  P+ S
Sbjct: 177 STEPPSSSTSPVQTTTTTAPETTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSS 230



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 5/54 (9%)
 Frame = +2

Query: 458 STRPPCTSPSK-PCSRCTRPVV----PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           ST PP +S S    +  T P      PP S  TP   + T  P T  T  P+ S
Sbjct: 798 STEPPSSSTSPVQTTTITAPETTSTEPPSSSNTPVQTTTTTAPETTSTEPPSSS 851


>Z75539-1|CAA99843.1|  672|Caenorhabditis elegans Hypothetical
           protein F28C1.1 protein.
          Length = 672

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = +3

Query: 537 GLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRAR 668
           G+ RR         R R+PPR  +   SR+R  R P     R R
Sbjct: 394 GMNRRSWSRSRSRSRSRSPPRRRSRSRSRTRDRRRPRRSNSRRR 437


>Z68317-3|CAA92687.1|  599|Caenorhabditis elegans Hypothetical
           protein T01H3.3 protein.
          Length = 599

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +2

Query: 512 PVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P++PP     PA V  T  P+T++T  P P
Sbjct: 97  PILPPTE--KPAPVITTETPTTRETEKPVP 124


>U58757-9|AAM75377.1|  503|Caenorhabditis elegans Hypothetical
           protein C01B10.6b protein.
          Length = 503

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 4/55 (7%)
 Frame = +2

Query: 446 CSKHSTRPP---CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPS-TKDTHSPT 598
           CS  +  PP   C  PS        PV P      P TV+PT  P+    T +PT
Sbjct: 388 CSPGAKSPPDQSCPKPSPTDPTPVPPVAPTPPSVCPTTVAPTTTPALLTSTIAPT 442


>U58757-8|AAC47918.3|  506|Caenorhabditis elegans Hypothetical
           protein C01B10.6a protein.
          Length = 506

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 4/55 (7%)
 Frame = +2

Query: 446 CSKHSTRPP---CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPS-TKDTHSPT 598
           CS  +  PP   C  PS        PV P      P TV+PT  P+    T +PT
Sbjct: 391 CSPGAKSPPDQSCPKPSPTDPTPVPPVAPTPPSVCPTTVAPTTTPALLTSTIAPT 445


>AF125964-1|AAD14753.1|  471|Caenorhabditis elegans Hypothetical
           protein W03G1.5 protein.
          Length = 471

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 32/113 (28%), Positives = 37/113 (32%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PRG       G P   G+     P H     H  H  R PSR        +H +  G   
Sbjct: 376 PRGHGHGGRHGPPHCPGRHGHHGPPH-----HHHHDGRSPSRH-----GHHHHHHHG--- 422

Query: 549 RCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRAGNRS 707
            C P   H      PP  P        P   P   PHR     H+H   G+RS
Sbjct: 423 -CRPFPPHHGHHHFPPFWPPC------PPPPPFWPPHRRGGHCHHHHHNGHRS 468


>AF039044-7|AAG24125.1|  125|Caenorhabditis elegans Hypothetical
           protein F48G7.9 protein.
          Length = 125

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +2

Query: 710 TSRRSCATSLLTSSRKWPPLHPAAPS 787
           +SRRS   S+ TS++ WP    +APS
Sbjct: 80  SSRRSSLASVSTSTKNWPSKSSSAPS 105


>AC024794-1|AAK68497.1|  994|Caenorhabditis elegans Hypothetical
           protein Y48G1BM.5 protein.
          Length = 994

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 4/57 (7%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSC----WTPATVSPTPCPSTKDTHSPTPS 604
           CS  +T    TS +   SR   P     SC    WT AT +P    +T    +P P+
Sbjct: 588 CSHATTIRRATSTTTRTSRTGVPTTTSRSCSTTIWTTATTTPATAATTPAGQTPIPT 644


>U28738-11|AAK68399.3|  166|Caenorhabditis elegans Sr protein
           (splicing factor) protein5, isoform b protein.
          Length = 166

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/54 (35%), Positives = 22/54 (40%)
 Frame = +3

Query: 531 RAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRR 692
           R G R      R+  RR RTPPR  +    R R  R       R+R  V   RR
Sbjct: 81  RHGSRSPRRRSRSPRRRSRTPPRRRSRSRDRKRSRRSRSRSSSRSRSPVRESRR 134


>U28738-10|AAK72066.3|  208|Caenorhabditis elegans Sr protein
           (splicing factor) protein5, isoform d protein.
          Length = 208

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/54 (35%), Positives = 22/54 (40%)
 Frame = +3

Query: 531 RAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRR 692
           R G R      R+  RR RTPPR  +    R R  R       R+R  V   RR
Sbjct: 81  RHGSRSPRRRSRSPRRRSRTPPRRRSRSRDRKRSRRSRSRSSSRSRSPVRESRR 134


>U28738-9|AAA68314.3|  208|Caenorhabditis elegans Sr protein
           (splicing factor) protein5, isoform a protein.
          Length = 208

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/54 (35%), Positives = 22/54 (40%)
 Frame = +3

Query: 531 RAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRR 692
           R G R      R+  RR RTPPR  +    R R  R       R+R  V   RR
Sbjct: 81  RHGSRSPRRRSRSPRRRSRTPPRRRSRSRDRKRSRRSRSRSSSRSRSPVRESRR 134


>U25032-1|AAB18670.1| 1379|Caenorhabditis elegans par-3 protein.
          Length = 1379

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/74 (21%), Positives = 36/74 (48%)
 Frame = +3

Query: 408  QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            + +G     DP H++  Q  +H R++ +   + + RS  + R+  +R    +R+ ++ + 
Sbjct: 866  EKRGMGAAADPQHIKLFQDIKHQRQNSAPTSSTQKRSKSQPRSSSQRN---YRSPMKLVD 922

Query: 588  TPPRHPASGLSRSR 629
             P    AS  + S+
Sbjct: 923  LPTTAAASASTNSQ 936


>U00067-5|ABD63219.1| 1340|Caenorhabditis elegans Abnormal embryonic
            partitioningof cytoplasm protein 3, isoform c protein.
          Length = 1340

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/74 (21%), Positives = 36/74 (48%)
 Frame = +3

Query: 408  QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            + +G     DP H++  Q  +H R++ +   + + RS  + R+  +R    +R+ ++ + 
Sbjct: 830  EKRGMGAAADPQHIKLFQDIKHQRQNSAPTSSTQKRSKSQPRSSSQRN---YRSPMKLVD 886

Query: 588  TPPRHPASGLSRSR 629
             P    AS  + S+
Sbjct: 887  LPTTAAASASTNSQ 900


>U00067-4|AAK73874.1| 1376|Caenorhabditis elegans Abnormal embryonic
            partitioningof cytoplasm protein 3, isoform a protein.
          Length = 1376

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/74 (21%), Positives = 36/74 (48%)
 Frame = +3

Query: 408  QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            + +G     DP H++  Q  +H R++ +   + + RS  + R+  +R    +R+ ++ + 
Sbjct: 866  EKRGMGAAADPQHIKLFQDIKHQRQNSAPTSSTQKRSKSQPRSSSQRN---YRSPMKLVD 922

Query: 588  TPPRHPASGLSRSR 629
             P    AS  + S+
Sbjct: 923  LPTTAAASASTNSQ 936


>U00067-3|AAK73875.1| 1379|Caenorhabditis elegans Abnormal embryonic
            partitioningof cytoplasm protein 3, isoform b protein.
          Length = 1379

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/74 (21%), Positives = 36/74 (48%)
 Frame = +3

Query: 408  QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            + +G     DP H++  Q  +H R++ +   + + RS  + R+  +R    +R+ ++ + 
Sbjct: 866  EKRGMGAAADPQHIKLFQDIKHQRQNSAPTSSTQKRSKSQPRSSSQRN---YRSPMKLVD 922

Query: 588  TPPRHPASGLSRSR 629
             P    AS  + S+
Sbjct: 923  LPTTAAASASTNSQ 936


>AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical
           protein Y18D10A.1 protein.
          Length = 1634

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/35 (40%), Positives = 15/35 (42%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCP 571
           PP  SPS P  R  RP         PA  + TP P
Sbjct: 510 PPSPSPSTPGRRGRRPRTLSTMSMEPAAAAVTPAP 544


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
            beta protein.
          Length = 1418

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +3

Query: 360  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 485
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1230 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1274


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
            beta homolog EGL-8 protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +3

Query: 360  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 485
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
            defective protein 8,isoform a protein.
          Length = 1419

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +3

Query: 360  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 485
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1231 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1275


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
            defective protein 8,isoform b protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +3

Query: 360  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 485
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287


>Z81461-6|CAB03837.1|  272|Caenorhabditis elegans Hypothetical
           protein C04F12.8 protein.
          Length = 272

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 29/104 (27%), Positives = 41/104 (39%), Gaps = 5/104 (4%)
 Frame = +3

Query: 366 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHP-----SRALAVRVRSYHRY 530
           R RGT S     +P+      +   D +R +Q  R + RH      S A   R  S   Y
Sbjct: 147 RLRGTASVKMVQTPECDMPIPDVYADDIRRMQINREISRHSLPSAQSSASKQRAFSASTY 206

Query: 531 RAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHR 662
           R  +        + LRR  +P   PAS L+ +  + L    P R
Sbjct: 207 RPSVSSASSLATSSLRRAYSPSSLPASSLALTTSYSLFSPAPTR 250


>Z69360-4|CAC42291.2|  732|Caenorhabditis elegans Hypothetical
           protein F25H8.5c protein.
          Length = 732

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P   P  PC +  +P  PP  C  P    P P P  + T    PS
Sbjct: 103 PPPGPPPPCQQYQQPQPPP--CQRPQPPQPQPQPYPQRTGGCLPS 145


>Z69360-3|CAA93286.2|  369|Caenorhabditis elegans Hypothetical
           protein F25H8.5b protein.
          Length = 369

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P   P  PC +  +P  PP  C  P    P P P  + T    PS
Sbjct: 103 PPPGPPPPCQQYQQPQPPP--CQRPQPPQPQPQPYPQRTGGCLPS 145


>Z69360-2|CAA93285.2|  780|Caenorhabditis elegans Hypothetical
           protein F25H8.5a protein.
          Length = 780

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P   P  PC +  +P  PP  C  P    P P P  + T    PS
Sbjct: 103 PPPGPPPPCQQYQQPQPPP--CQRPQPPQPQPQPYPQRTGGCLPS 145


>U64857-15|AAC25858.1|  470|Caenorhabditis elegans Hypothetical
           protein C37C3.1 protein.
          Length = 470

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 1/69 (1%)
 Frame = +3

Query: 465 ARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPH-RL 641
           AR   RH SR+ +      H  R+    R    R    R R+PPR      SRSR   R 
Sbjct: 312 ARRRSRHLSRSGSRTPAQRHSRRSESTSRRRSGRHSRSRSRSPPRKRPVRRSRSRSRSRT 371

Query: 642 PHEDPHRAR 668
           P+ +  RAR
Sbjct: 372 PNRNWTRAR 380


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +1

Query: 130 KAGFAGDDAPRAVFPSIVGRPRHQG 204
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical
            protein Y40C5A.3 protein.
          Length = 2344

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 20/88 (22%), Positives = 31/88 (35%)
 Frame = +2

Query: 347  STMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVPP 526
            S+++ V PP N+ S                       +  PP +SPS P        +P 
Sbjct: 1580 SSVASVKPPSNSSSVGQNIEVTVPSYFPVEQSKSVTQAPIPPASSPSAPSIPSIPSTLPV 1639

Query: 527  VSCWTPATVSPTPCPSTKDTHSPTPSCV 610
                +    SP+    +  T S TP+ V
Sbjct: 1640 APSSSSVPSSPSAPSESTSTVSETPAPV 1667


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,694,457
Number of Sequences: 27780
Number of extensions: 482436
Number of successful extensions: 2528
Number of sequences better than 10.0: 83
Number of HSP's better than 10.0 without gapping: 1970
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2492
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1914239236
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).