SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81458-4|CAB03824.1|  623|Caenorhabditis elegans Hypothetical pr...    33   0.19 
Z35662-1|CAA84721.1| 4307|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z35599-4|CAA84661.1| 4307|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z34802-10|CAA84339.1| 4307|Caenorhabditis elegans Hypothetical p...    31   1.3  
AL031630-22|CAA20995.2|  454|Caenorhabditis elegans Hypothetical...    31   1.3  
Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical pr...    29   4.1  
U64848-9|AAB04887.1|  128|Caenorhabditis elegans Hypothetical pr...    29   5.4  
AF067613-14|ABA54416.1|  395|Caenorhabditis elegans Hypothetical...    29   5.4  
Z73976-8|CAI79223.1|  215|Caenorhabditis elegans Hypothetical pr...    28   7.2  
U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr...    28   9.5  
U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical pr...    28   9.5  
AL031633-19|CAA21031.1|  710|Caenorhabditis elegans Hypothetical...    28   9.5  

>Z81458-4|CAB03824.1|  623|Caenorhabditis elegans Hypothetical
           protein C03E10.5 protein.
          Length = 623

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 SSTGAAKSFCVKLGPVLLRTASPL*TTKR*WTCTSSPTSNPHAPTGATSSSLNTLLGGKK 460
           SST +  S  +      + T++P  T K   T TS+PTS   + T A  ++ +       
Sbjct: 162 SSTASVSSTILSSTATTMVTSTPT-TEKSSTTTTSTPTSEATSTTTAMITTTSGTTENPT 220

Query: 461 TT-CPTK*SELWSHPT 505
           TT CPTK      HPT
Sbjct: 221 TTDCPTKVCRYGFHPT 236


>Z35662-1|CAA84721.1| 4307|Caenorhabditis elegans Hypothetical protein
            F25F2.2 protein.
          Length = 4307

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = -1

Query: 489  NSDYFVGHVVF-FPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYNGEAVLNKTGPSF 313
            NS YFVGH  F F  +S   ++++A V A   + G+   V + +V  N E++      S 
Sbjct: 1478 NSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG 1537

Query: 312  TQKLFAAPVD 283
              +L A P+D
Sbjct: 1538 EVRL-AKPLD 1546


>Z35599-4|CAA84661.1| 4307|Caenorhabditis elegans Hypothetical protein
            F25F2.2 protein.
          Length = 4307

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = -1

Query: 489  NSDYFVGHVVF-FPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYNGEAVLNKTGPSF 313
            NS YFVGH  F F  +S   ++++A V A   + G+   V + +V  N E++      S 
Sbjct: 1478 NSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG 1537

Query: 312  TQKLFAAPVD 283
              +L A P+D
Sbjct: 1538 EVRL-AKPLD 1546


>Z34802-10|CAA84339.1| 4307|Caenorhabditis elegans Hypothetical
            protein F25F2.2 protein.
          Length = 4307

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = -1

Query: 489  NSDYFVGHVVF-FPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYNGEAVLNKTGPSF 313
            NS YFVGH  F F  +S   ++++A V A   + G+   V + +V  N E++      S 
Sbjct: 1478 NSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG 1537

Query: 312  TQKLFAAPVD 283
              +L A P+D
Sbjct: 1538 EVRL-AKPLD 1546


>AL031630-22|CAA20995.2|  454|Caenorhabditis elegans Hypothetical
           protein Y38H6C.17 protein.
          Length = 454

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -2

Query: 593 ELVYSLWMFMIGQPPPFLARLILYSLFMP 507
           E +  +W F+ G PPPF   +++   F+P
Sbjct: 151 EHIIEIWQFIAGSPPPFSKIVLILMYFVP 179


>Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical
           protein C30H6.11 protein.
          Length = 460

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = +2

Query: 338 TASPL*TTKR*WTCTSSPTSNPHAPTGATSSSLNTLLGGKKTTCPTK*SELWSHPTWA*T 517
           T +P  TT    T T++PT+   APT  T++   T      TT  T  +   + PT   T
Sbjct: 172 TTTPTTTTTTPTTTTTTPTTTTTAPTTTTTTPTTTTT--TPTTTTTVPTTTTTTPTTTTT 229

Query: 518 TNT 526
           T T
Sbjct: 230 TTT 232



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = +2

Query: 338 TASPL*TTKR*WTCTSSPTSNPHAPTGATSSSLNTLLGGKKTTCPTK*SELWSHPTWA*T 517
           T +P  TT    T T++PT+    PT  T+ +  T      TT PT  ++  + PT   T
Sbjct: 221 TTTPTTTT----TTTTTPTTTTTTPTTTTTPATTT--SETTTTTPTTTTQTTTKPTTTTT 274

Query: 518 TNT 526
           T T
Sbjct: 275 TPT 277


>U64848-9|AAB04887.1|  128|Caenorhabditis elegans Hypothetical
           protein C50E3.3 protein.
          Length = 128

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = -3

Query: 412 WGVWV*GWRRGTRPSPLGRLQWGSCPQQNGSKFHAKTLCRSS 287
           WGVW      GTR +  G  +   C    G KF+ KTL   S
Sbjct: 24  WGVWF----DGTRKTKCGPSELTQCNSLKGFKFNDKTLVSKS 61


>AF067613-14|ABA54416.1|  395|Caenorhabditis elegans Hypothetical
           protein F56D6.15 protein.
          Length = 395

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = +2

Query: 362 KR*WTCTSSPTSNPHA--PTGATSSSLNTLLGGKKT 463
           K  + C+  PT  P A  PT  T++++N  LGG++T
Sbjct: 113 KNYFVCSYDPTVQPKATTPTTTTAANVNCPLGGQQT 148


>Z73976-8|CAI79223.1|  215|Caenorhabditis elegans Hypothetical
           protein T07C12.14 protein.
          Length = 215

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +1

Query: 127 KHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVK 261
           +HL + E E K+ D+L   ++AE  ++      +   F+E R  K
Sbjct: 35  EHLTQEEYERKKTDILRRAVLAESQYIALRTQLRDNKFREAREYK 79


>U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical protein
            K06A9.1b protein.
          Length = 2232

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 26/75 (34%), Positives = 36/75 (48%)
 Frame = +2

Query: 281  SSTGAAKSFCVKLGPVLLRTASPL*TTKR*WTCTSSPTSNPHAPTGATSSSLNTLLGGKK 460
            S++G   S    L  + + T SP  +T+   T TS P+S+P   T + SSS  T +    
Sbjct: 1960 STSGTNPSSPRSLSQITI-TPSPSQSTES--TQTSLPSSSPSPSTHSVSSSEGTTMSSGA 2016

Query: 461  TTCPTK*SELWSHPT 505
            TT   K S L S  T
Sbjct: 2017 TTSGDKMSFLSSTGT 2031


>U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical
           protein F37A4.4 protein.
          Length = 1163

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = -2

Query: 611 FTNDSNELVYSLWMFMIGQPPPFLARLILYSLFMPT*DGSTILITS 474
           FT++      +L+++  G+   +  R   YSLFM   DG  +LI S
Sbjct: 787 FTSNGRNQYINLYLYYFGKTSDYEKRW-RYSLFMDRVDGKNVLIDS 831


>AL031633-19|CAA21031.1|  710|Caenorhabditis elegans Hypothetical
           protein Y39A1A.22 protein.
          Length = 710

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 23/106 (21%), Positives = 44/106 (41%)
 Frame = +1

Query: 124 KKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVNWSGKE 303
           +K   E +QE  + +L  +  +AE          +L +FK++   + DT  +   + GK+
Sbjct: 52  EKFFNECDQELTKINLFFSQKIAEGQGKHHELQTELQVFKDVLGSRSDTTGIRRRFGGKD 111

Query: 304 FLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQH 441
              +  TR  E    +   +  + + LV N +        K L +H
Sbjct: 112 KFHKETTR-NEQQLKLAFSEFYLSLVLVQNFQQLNATGFRKILKKH 156


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,040,996
Number of Sequences: 27780
Number of extensions: 445205
Number of successful extensions: 1289
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1192
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1282
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2066533546
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).