SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81106-5|CAB03223.3|  432|Caenorhabditis elegans Hypothetical pr...    29   5.5  
AL033536-12|CAD45609.2|  432|Caenorhabditis elegans Hypothetical...    29   5.5  
AL032657-5|CAD27615.1| 1045|Caenorhabditis elegans Hypothetical ...    28   9.7  
AL032657-4|CAD27614.1| 1070|Caenorhabditis elegans Hypothetical ...    28   9.7  
AL032657-3|CAA21739.1| 1111|Caenorhabditis elegans Hypothetical ...    28   9.7  
AF332568-1|AAG60061.1| 1111|Caenorhabditis elegans CED-1 protein.      28   9.7  
AF078783-1|AAK82900.1|  382|Caenorhabditis elegans Hypothetical ...    28   9.7  

>Z81106-5|CAB03223.3|  432|Caenorhabditis elegans Hypothetical
           protein R06C1.6 protein.
          Length = 432

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 17/58 (29%), Positives = 23/58 (39%)
 Frame = +3

Query: 192 SGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTPRSQNQP 365
           SG   L SP S  Y   + +      +  +NN  QR+  P +G P   P      N P
Sbjct: 180 SGFPDLGSPGSSNYNPASQKSSPPLSKYSQNNQGQRNSPPNHGYPNMSPYMTSQMNSP 237


>AL033536-12|CAD45609.2|  432|Caenorhabditis elegans Hypothetical
           protein R06C1.6 protein.
          Length = 432

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 17/58 (29%), Positives = 23/58 (39%)
 Frame = +3

Query: 192 SGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTPRSQNQP 365
           SG   L SP S  Y   + +      +  +NN  QR+  P +G P   P      N P
Sbjct: 180 SGFPDLGSPGSSNYNPASQKSSPPLSKYSQNNQGQRNSPPNHGYPNMSPYMTSQMNSP 237


>AL032657-5|CAD27615.1| 1045|Caenorhabditis elegans Hypothetical
            protein Y47H9C.4c protein.
          Length = 1045

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +3

Query: 273  KKKNNDDQRS-RSPRYGDPIRPPDTPRSQNQPAGSERDTPPTGLL 404
            K  NND+ R  ++P Y      PD+    ++  G+ +  PP GLL
Sbjct: 950  KAPNNDEGREFQNPLYSRQSVFPDSDAFSSENNGNHQGGPPNGLL 994


>AL032657-4|CAD27614.1| 1070|Caenorhabditis elegans Hypothetical
            protein Y47H9C.4b protein.
          Length = 1070

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +3

Query: 273  KKKNNDDQRS-RSPRYGDPIRPPDTPRSQNQPAGSERDTPPTGLL 404
            K  NND+ R  ++P Y      PD+    ++  G+ +  PP GLL
Sbjct: 950  KAPNNDEGREFQNPLYSRQSVFPDSDAFSSENNGNHQGGPPNGLL 994


>AL032657-3|CAA21739.1| 1111|Caenorhabditis elegans Hypothetical
            protein Y47H9C.4a protein.
          Length = 1111

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +3

Query: 273  KKKNNDDQRS-RSPRYGDPIRPPDTPRSQNQPAGSERDTPPTGLL 404
            K  NND+ R  ++P Y      PD+    ++  G+ +  PP GLL
Sbjct: 950  KAPNNDEGREFQNPLYSRQSVFPDSDAFSSENNGNHQGGPPNGLL 994


>AF332568-1|AAG60061.1| 1111|Caenorhabditis elegans CED-1 protein.
          Length = 1111

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +3

Query: 273  KKKNNDDQRS-RSPRYGDPIRPPDTPRSQNQPAGSERDTPPTGLL 404
            K  NND+ R  ++P Y      PD+    ++  G+ +  PP GLL
Sbjct: 950  KAPNNDEGREFQNPLYSRQSVFPDSDAFSSENNGNHQGGPPNGLL 994


>AF078783-1|AAK82900.1|  382|Caenorhabditis elegans Hypothetical
           protein H10E21.2 protein.
          Length = 382

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = +1

Query: 253 ATSSDRKKKKTMTTNEAGLHDTATPSGRRIPRGVRTSLPGQNAIPRRPDYSCT 411
           +T    ++KK MT   AG +  ATP+    P    T+    N  PRR  YSC+
Sbjct: 274 STIMTSQRKKLMTIR-AGAYQVATPTKILFPDDNCTARVCANLAPRR-QYSCS 324


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,583,932
Number of Sequences: 27780
Number of extensions: 386904
Number of successful extensions: 1023
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 971
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1023
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2118983636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).