SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40933-5|AAA81675.1| 1116|Caenorhabditis elegans Hypothetical pr...    33   0.41 
AF036702-14|AAB88378.2|  396|Caenorhabditis elegans Hypothetical...    32   0.72 
AF036702-13|AAB88379.2|  648|Caenorhabditis elegans Hypothetical...    32   0.72 
AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical ...    31   1.3  
Z99279-6|CAB16498.1|  640|Caenorhabditis elegans Hypothetical pr...    30   2.2  
Z82284-8|CAB05294.1|  640|Caenorhabditis elegans Hypothetical pr...    30   2.2  
Z83223-6|CAB05719.1|  884|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z81542-10|CAB04419.4|  411|Caenorhabditis elegans Hypothetical p...    29   3.8  
Z81538-6|CAB04387.1|  884|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z74026-5|CAA98419.3| 3517|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z72513-4|CAA96672.3| 3517|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical pr...    29   3.8  
AF435953-1|AAL30829.1| 1077|Caenorhabditis elegans eIF2 alpha ki...    29   3.8  
AF193341-1|AAF61201.1| 1077|Caenorhabditis elegans eukaryotic tr...    29   3.8  
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    29   3.8  
AF000265-7|AAB52941.1|  893|Caenorhabditis elegans Hypothetical ...    29   3.8  
AL132860-31|CAB60519.2|  457|Caenorhabditis elegans Hypothetical...    29   5.1  
AF040657-6|AAB95051.2|  261|Caenorhabditis elegans Hypothetical ...    29   5.1  
Z81449-11|CAD44106.2|  410|Caenorhabditis elegans Hypothetical p...    28   8.9  
Z81449-10|CAB03766.4|  419|Caenorhabditis elegans Hypothetical p...    28   8.9  
Z48241-6|CAD44100.2|  410|Caenorhabditis elegans Hypothetical pr...    28   8.9  
Z48241-5|CAA88286.4|  419|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical pr...    28   8.9  
U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical pr...    28   8.9  

>U40933-5|AAA81675.1| 1116|Caenorhabditis elegans Hypothetical protein
            F20D12.2 protein.
          Length = 1116

 Score = 32.7 bits (71), Expect = 0.41
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 2/97 (2%)
 Frame = +2

Query: 593  HSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD 772
            + S ++  +P  S+      LQ    E +L T   E + +     E    E +++  +D+
Sbjct: 1007 NDSQITVHSPDTSISIARRHLQDWEPEAVLPTELKEKIKRKRESFEKVFEEHSKKKKQDE 1066

Query: 773  --LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSR 877
              +SN+ +   V ++ V      L DE+L  T E+ R
Sbjct: 1067 ELISNEAKANSVHMKQVSVEADALLDETLRYTAELER 1103


>AF036702-14|AAB88378.2|  396|Caenorhabditis elegans Hypothetical
           protein F33D4.6a protein.
          Length = 396

 Score = 31.9 bits (69), Expect = 0.72
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 11/119 (9%)
 Frame = +2

Query: 644 AEALQASATEDILTTLPTEPVVQTPP--LQEPAIN-ETTRRTPKDDL-----SNDIETL- 796
           A+  Q +  ++ + TLP  P+V  PP  LQ PA++  TT   P  ++     + D +T+ 
Sbjct: 182 AQKPQQTPQQEPMITLP--PLVPLPPVPLQMPALHIPTTAAQPVTEIMYRPVTRDGKTVY 239

Query: 797 --LVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQT 967
             +V +++    +  LP+  L+   EVS +     QV+  S A        PP + + T
Sbjct: 240 EQVVVLKEANGSVKILPNTLLQQLPEVSTKRVEIKQVKSRSEATEFLAPTFPPMINLFT 298


>AF036702-13|AAB88379.2|  648|Caenorhabditis elegans Hypothetical
           protein F33D4.6b protein.
          Length = 648

 Score = 31.9 bits (69), Expect = 0.72
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 11/119 (9%)
 Frame = +2

Query: 644 AEALQASATEDILTTLPTEPVVQTPP--LQEPAIN-ETTRRTPKDDL-----SNDIETL- 796
           A+  Q +  ++ + TLP  P+V  PP  LQ PA++  TT   P  ++     + D +T+ 
Sbjct: 182 AQKPQQTPQQEPMITLP--PLVPLPPVPLQMPALHIPTTAAQPVTEIMYRPVTRDGKTVY 239

Query: 797 --LVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQT 967
             +V +++    +  LP+  L+   EVS +     QV+  S A        PP + + T
Sbjct: 240 EQVVVLKEANGSVKILPNTLLQQLPEVSTKRVEIKQVKSRSEATEFLAPTFPPMINLFT 298


>AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical
           protein M01E10.2 protein.
          Length = 1286

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRR 757
           T S   + N +     ++EDI  +  T P  QTPP Q P    TTRR
Sbjct: 253 TTSQPAEFNIDDDDYESSEDISESHTTPPT-QTPPTQTPPTTTTTRR 298


>Z99279-6|CAB16498.1|  640|Caenorhabditis elegans Hypothetical
           protein Y57G11A.2 protein.
          Length = 640

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +2

Query: 569 GGICSWKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQ-EPAINE 745
           GG+   +D     S     +S+DSN E L AS+  +I      +P       + +P    
Sbjct: 290 GGLVLGEDDPEKTSVAPEVESVDSNGEDLAASSNGEISEIPTVDPTTSGENSESDPVFEV 349

Query: 746 TTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRA 919
               +    ++N  E    +   V+   ++ P E + ATE+ +   +N ++V  S+ A
Sbjct: 350 VDPSSAPPAVANADENAWSQ--QVEQGSSEAPVE-MTATEDTAEETNNESEVEASTEA 404


>Z82284-8|CAB05294.1|  640|Caenorhabditis elegans Hypothetical
           protein Y57G11A.2 protein.
          Length = 640

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +2

Query: 569 GGICSWKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQ-EPAINE 745
           GG+   +D     S     +S+DSN E L AS+  +I      +P       + +P    
Sbjct: 290 GGLVLGEDDPEKTSVAPEVESVDSNGEDLAASSNGEISEIPTVDPTTSGENSESDPVFEV 349

Query: 746 TTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRA 919
               +    ++N  E    +   V+   ++ P E + ATE+ +   +N ++V  S+ A
Sbjct: 350 VDPSSAPPAVANADENAWSQ--QVEQGSSEAPVE-MTATEDTAEETNNESEVEASTEA 404


>Z83223-6|CAB05719.1|  884|Caenorhabditis elegans Hypothetical
           protein E01G4.6 protein.
          Length = 884

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = +2

Query: 671 EDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDES 850
           ED++T   ++  V+  P +     ETT    +   +  +E    E+ +  T  T+ P   
Sbjct: 274 EDLVTETSSKLAVEEAPEETTTQEETTTDASEVTTTKAVEEATEEVTEEATEATEAP--- 330

Query: 851 LEATEEVSRRESNFNQVRRSSRAVGAED 934
           +  T+E S  E + N +R   R+   +D
Sbjct: 331 VATTKESS--EMHVNTIRNMIRSASEKD 356


>Z81542-10|CAB04419.4|  411|Caenorhabditis elegans Hypothetical
           protein F49A5.7 protein.
          Length = 411

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 3/83 (3%)
 Frame = +2

Query: 623 SDSLDSNAEALQASATEDILTTLPTEPVVQTPPL---QEPAINETTRRTPKDDLSNDIET 793
           SDS  +N+EAL +S T   +TT  T     +  L      A   +T RT    +  +  T
Sbjct: 69  SDS--TNSEALSSSTTNIPMTTFSTNEASSSTKLLSTSSTAEISSTTRTVSRSIKPETST 126

Query: 794 LLVEIRDVQTRLTDLPDESLEAT 862
               IR + T  T  P  ++  T
Sbjct: 127 ASTTIRPLTTTTTPAPSNNVGCT 149


>Z81538-6|CAB04387.1|  884|Caenorhabditis elegans Hypothetical
           protein E01G4.6 protein.
          Length = 884

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = +2

Query: 671 EDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDES 850
           ED++T   ++  V+  P +     ETT    +   +  +E    E+ +  T  T+ P   
Sbjct: 274 EDLVTETSSKLAVEEAPEETTTQEETTTDASEVTTTKAVEEATEEVTEEATEATEAP--- 330

Query: 851 LEATEEVSRRESNFNQVRRSSRAVGAED 934
           +  T+E S  E + N +R   R+   +D
Sbjct: 331 VATTKESS--EMHVNTIRNMIRSASEKD 356


>Z74026-5|CAA98419.3| 3517|Caenorhabditis elegans Hypothetical protein
            T04F3.1 protein.
          Length = 3517

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 1/91 (1%)
 Frame = +2

Query: 716  PPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFN 895
            PP      ++ T   P+  L  D+E   ++   V T   +L DES+E       ++S  +
Sbjct: 990  PPRSGKRKSDATENQPEITLELDVEKHEIDSSKVSTSTINLNDESMETRNTNDSKDSFDD 1049

Query: 896  QVR-RSSRAVGAEDHGVPPEVEVQTLIKNSS 985
            +V  R+ R V       P      T+   SS
Sbjct: 1050 EVNPRNQRLVVEIPFSEPRVTSTATIQLESS 1080


>Z72513-4|CAA96672.3| 3517|Caenorhabditis elegans Hypothetical protein
            T04F3.1 protein.
          Length = 3517

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 1/91 (1%)
 Frame = +2

Query: 716  PPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFN 895
            PP      ++ T   P+  L  D+E   ++   V T   +L DES+E       ++S  +
Sbjct: 990  PPRSGKRKSDATENQPEITLELDVEKHEIDSSKVSTSTINLNDESMETRNTNDSKDSFDD 1049

Query: 896  QVR-RSSRAVGAEDHGVPPEVEVQTLIKNSS 985
            +V  R+ R V       P      T+   SS
Sbjct: 1050 EVNPRNQRLVVEIPFSEPRVTSTATIQLESS 1080


>Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical
           protein F46C3.1 protein.
          Length = 1077

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +2

Query: 245 IVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSKPTSA 424
           I    QP+ KP+   +KTD+  D ++  ND K    K L  +      +S +     TS 
Sbjct: 548 IETHTQPQIKPVQRLVKTDIDTDEDSFSNDEK----KRLLRNRT----ISRSSLEGFTSR 599

Query: 425 VGDDFEVK 448
             ++FEVK
Sbjct: 600 FANEFEVK 607


>Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical
           protein F46C3.1 protein.
          Length = 1077

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +2

Query: 245 IVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSKPTSA 424
           I    QP+ KP+   +KTD+  D ++  ND K    K L  +      +S +     TS 
Sbjct: 548 IETHTQPQIKPVQRLVKTDIDTDEDSFSNDEK----KRLLRNRT----ISRSSLEGFTSR 599

Query: 425 VGDDFEVK 448
             ++FEVK
Sbjct: 600 FANEFEVK 607


>AF435953-1|AAL30829.1| 1077|Caenorhabditis elegans eIF2 alpha
           kinase protein.
          Length = 1077

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +2

Query: 245 IVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSKPTSA 424
           I    QP+ KP+   +KTD+  D ++  ND K    K L  +      +S +     TS 
Sbjct: 548 IETHTQPQIKPVQRLVKTDIDTDEDSFSNDEK----KRLLRNRT----ISRSSLEGFTSR 599

Query: 425 VGDDFEVK 448
             ++FEVK
Sbjct: 600 FANEFEVK 607


>AF193341-1|AAF61201.1| 1077|Caenorhabditis elegans eukaryotic
           translation initiationfactor 2 alpha kinase PEK protein.
          Length = 1077

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +2

Query: 245 IVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSKPTSA 424
           I    QP+ KP+   +KTD+  D ++  ND K    K L  +      +S +     TS 
Sbjct: 548 IETHTQPQIKPVQRLVKTDIDTDEDSFSNDEK----KRLLRNRT----ISRSSLEGFTSR 599

Query: 425 VGDDFEVK 448
             ++FEVK
Sbjct: 600 FANEFEVK 607


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
            assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +2

Query: 596  SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAI 739
            S+  SA+TPS S+ S +    A+A     +     P++ T  +Q PAI
Sbjct: 2875 SAVASAQTPSTSVPSTSSQAAAAAASSANSGEDINPLLLTALMQNPAI 2922


>AF000265-7|AAB52941.1|  893|Caenorhabditis elegans Hypothetical
           protein C18E3.3 protein.
          Length = 893

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 788 ETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           +T L++I D     T LPD+  E   E+     NF+QV
Sbjct: 550 DTDLIDIEDSSAHETILPDQEKEEDAEIISTTQNFSQV 587


>AL132860-31|CAB60519.2|  457|Caenorhabditis elegans Hypothetical
           protein Y56A3A.7a protein.
          Length = 457

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 28/115 (24%), Positives = 47/115 (40%)
 Frame = +2

Query: 605 LSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSND 784
           L+ ETP  S +  AEA  A+      TT+ + PV  +  + E    E T ++  DD+  +
Sbjct: 352 LTPETPRPSQEDEAEAPAAAE-----TTVVSAPVAASEDIDEEEDGEVTEKS-LDDILEN 405

Query: 785 IETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPP 949
               L  +  ++ RL     E ++ T      E +   + R       ED  + P
Sbjct: 406 ARANLSNLTAMRERL-----EHIKETGGADLNEDDLTLLERLDNVALEEDEKLTP 455


>AF040657-6|AAB95051.2|  261|Caenorhabditis elegans Hypothetical
           protein T20H9.2 protein.
          Length = 261

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 365 HDAECQYFLSMAKKSKPTSAVGDDFEVKDQNDKDR 469
           H  E   F+ +AK  KP  A G++FE+   ND D+
Sbjct: 182 HYTERIDFIEIAKVFKPEYAGGNEFEIVYSNDDDK 216


>Z81449-11|CAD44106.2|  410|Caenorhabditis elegans Hypothetical
           protein C32A3.3b protein.
          Length = 410

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 15/53 (28%), Positives = 30/53 (56%)
 Frame = +2

Query: 743 ETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           E T R   DDL   +++L+ E R++ T ++ LP+ + ++    S RE++   +
Sbjct: 94  EKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHA-DSPVSTSMREADLKML 145


>Z81449-10|CAB03766.4|  419|Caenorhabditis elegans Hypothetical
           protein C32A3.3a protein.
          Length = 419

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 15/53 (28%), Positives = 30/53 (56%)
 Frame = +2

Query: 743 ETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           E T R   DDL   +++L+ E R++ T ++ LP+ + ++    S RE++   +
Sbjct: 103 EKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHA-DSPVSTSMREADLKML 154


>Z48241-6|CAD44100.2|  410|Caenorhabditis elegans Hypothetical
           protein C32A3.3b protein.
          Length = 410

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 15/53 (28%), Positives = 30/53 (56%)
 Frame = +2

Query: 743 ETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           E T R   DDL   +++L+ E R++ T ++ LP+ + ++    S RE++   +
Sbjct: 94  EKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHA-DSPVSTSMREADLKML 145


>Z48241-5|CAA88286.4|  419|Caenorhabditis elegans Hypothetical
           protein C32A3.3a protein.
          Length = 419

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 15/53 (28%), Positives = 30/53 (56%)
 Frame = +2

Query: 743 ETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           E T R   DDL   +++L+ E R++ T ++ LP+ + ++    S RE++   +
Sbjct: 103 EKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHA-DSPVSTSMREADLKML 154


>U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical
           protein R03G5.3 protein.
          Length = 1311

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 4/78 (5%)
 Frame = -2

Query: 381 WHSASWYKCFS--TQNLLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGGVLSFLSFC*T 208
           WH  ++    S  T+++LS     +++ TS  KL  + F F    F I    +F  FC T
Sbjct: 623 WHYLAYAIILSIFTRDMLSRIEIRVASVTSTLKLVLLVFDFNTNTFQINSNYNFTWFCRT 682

Query: 207 NNNS--ASSVAYLFIQKL 160
              +   S+  +LF  +L
Sbjct: 683 QKLTMILSTAVFLFSLEL 700


>U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical protein
            C27F2.8 protein.
          Length = 1715

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +2

Query: 623  SDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQ---EPAINETTRRTPKDDLSN 781
            S S      A Q     ++   +  +PVVQ+PP+Q   EPA   T   +PK   +N
Sbjct: 1257 SKSQRKKKRAAQQKENNNLEAPIIVQPVVQSPPVQNKMEPAKKTTPGPSPKPKGNN 1312


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,454,326
Number of Sequences: 27780
Number of extensions: 383999
Number of successful extensions: 1590
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1435
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1583
length of database: 12,740,198
effective HSP length: 82
effective length of database: 10,462,238
effective search space used: 2563248310
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).