SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83316-9|CAN99655.1|  250|Caenorhabditis elegans Hypothetical pr...   173   1e-43
Z83316-6|CAD30429.2|  491|Caenorhabditis elegans Hypothetical pr...   173   1e-43
Z83316-5|CAD30428.2|  345|Caenorhabditis elegans Hypothetical pr...   173   1e-43
AC006780-5|AAF60646.1|  287|Caenorhabditis elegans Hypothetical ...   100   9e-22
AC006780-4|AAO21411.1|  312|Caenorhabditis elegans Hypothetical ...   100   9e-22
U29536-5|AAA68794.1|  246|Caenorhabditis elegans Hypothetical pr...    80   1e-15
Z81532-3|CAC70088.2|  659|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z73098-12|CAA97339.1|  452|Caenorhabditis elegans Hypothetical p...    38   0.005
AF068708-5|AAK68200.1|  628|Caenorhabditis elegans P granule abn...    30   1.4  
AF068708-4|AAC17755.1|  693|Caenorhabditis elegans P granule abn...    30   1.4  
AC024844-8|AAK29951.1|  421|Caenorhabditis elegans Hypothetical ...    30   1.4  
AB120729-1|BAC87886.1|  693|Caenorhabditis elegans PGL-3 protein.      30   1.4  
U88172-11|AAB42257.1|  390|Caenorhabditis elegans Hypothetical p...    30   1.9  
U88172-10|AAM97988.1|  437|Caenorhabditis elegans Hypothetical p...    30   1.9  
AF016426-1|AAB65347.2|  254|Caenorhabditis elegans Hypothetical ...    29   3.3  
U39852-7|AAK39260.1|  240|Caenorhabditis elegans Ground-like (gr...    29   4.4  
AF067608-13|AAK95862.1| 1634|Caenorhabditis elegans Hypothetical...    28   7.7  

>Z83316-9|CAN99655.1|  250|Caenorhabditis elegans Hypothetical
           protein B0379.4c protein.
          Length = 250

 Score =  173 bits (421), Expect = 1e-43
 Identities = 79/106 (74%), Positives = 91/106 (85%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+ N  FV+PVEIDG  HQVYVLKRP+VDEFL + GE + C+
Sbjct: 70  KKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECI 129

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+  VFR RLFR++CVFH+GNYVKDL+ L
Sbjct: 130 LFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRL 175


>Z83316-6|CAD30429.2|  491|Caenorhabditis elegans Hypothetical
           protein B0379.4b protein.
          Length = 491

 Score =  173 bits (421), Expect = 1e-43
 Identities = 79/106 (74%), Positives = 91/106 (85%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+ N  FV+PVEIDG  HQVYVLKRP+VDEFL + GE + C+
Sbjct: 311 KKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECI 370

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+  VFR RLFR++CVFH+GNYVKDL+ L
Sbjct: 371 LFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRL 416


>Z83316-5|CAD30428.2|  345|Caenorhabditis elegans Hypothetical
           protein B0379.4a protein.
          Length = 345

 Score =  173 bits (421), Expect = 1e-43
 Identities = 79/106 (74%), Positives = 91/106 (85%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+ N  FV+PVEIDG  HQVYVLKRP+VDEFL + GE + C+
Sbjct: 165 KKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECI 224

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+  VFR RLFR++CVFH+GNYVKDL+ L
Sbjct: 225 LFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRL 270


>AC006780-5|AAF60646.1|  287|Caenorhabditis elegans Hypothetical
           protein Y47D9A.2a protein.
          Length = 287

 Score =  100 bits (240), Expect = 9e-22
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S  P++NA  V PV      +QVYV  RPH+  FL R  +
Sbjct: 59  TRSTPEYTLVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQVYVRLRPHLRTFLSRMAK 118

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +  ++FTAS   YA+ + D+LD R    R RLFR+ CV   GNYVKDL  L
Sbjct: 119 TFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTIL 170


>AC006780-4|AAO21411.1|  312|Caenorhabditis elegans Hypothetical
           protein Y47D9A.2b protein.
          Length = 312

 Score =  100 bits (240), Expect = 9e-22
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S  P++NA  V PV      +QVYV  RPH+  FL R  +
Sbjct: 59  TRSTPEYTLVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQVYVRLRPHLRTFLSRMAK 118

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +  ++FTAS   YA+ + D+LD R    R RLFR+ CV   GNYVKDL  L
Sbjct: 119 TFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTIL 170


>U29536-5|AAA68794.1|  246|Caenorhabditis elegans Hypothetical
           protein F45E12.1 protein.
          Length = 246

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 47/118 (39%), Positives = 65/118 (55%), Gaps = 9/118 (7%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEF 550
           T  + ++V+DLDETL+HS        + KP   + F + V ID    +  V +RPHVD F
Sbjct: 54  TVKRKILVLDLDETLIHSHHDGVLRQTVKPGTPSDFTIRVVIDRHPVKFSVHERPHVDYF 113

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDLNSL 721
           L    + Y  V+FTAS+  Y   VAD LDR  G+ + R FR  C    G Y KDL+++
Sbjct: 114 LSVVSQWYELVVFTASMEVYGTSVADRLDRGRGILKRRYFRQHCTMEVGGYTKDLSAI 171


>Z81532-3|CAC70088.2|  659|Caenorhabditis elegans Hypothetical
           protein F36F2.6 protein.
          Length = 659

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 6/109 (5%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEIDGAVHQVYVLK-RPHVDEFLRRCGELY* 577
           K V+++DLD+T++H+S KP+  +      +       +VY  K RPH  EFL +   +Y 
Sbjct: 143 KLVLLVDLDQTIIHTSDKPMTVDTENHKDITKYNLHSRVYTTKLRPHTTEFLNKMSNMYE 202

Query: 578 CVLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVF---HRGNYVKDL 712
             + T    +YA  +A +LD    +F  R+     +F   H+ N +K L
Sbjct: 203 MHIVTYGQRQYAHRIAQILDPDARLFEQRILSRDELFSAQHKTNNLKAL 251


>Z73098-12|CAA97339.1|  452|Caenorhabditis elegans Hypothetical
           protein T21C9.12 protein.
          Length = 452

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCG-ELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNY 700
           LKRP +D FL   G   +  V++++     A PV D  D       +LFRD   +  G++
Sbjct: 272 LKRPALDYFLDVIGYPNFEVVIYSSESMMTAAPVVDSFDPKQRIMYKLFRDCTKYMNGHH 331

Query: 701 VKDLNSL 721
           VKDL+ L
Sbjct: 332 VKDLSKL 338


>AF068708-5|AAK68200.1|  628|Caenorhabditis elegans P granule
           abnormality protein 3,isoform b protein.
          Length = 628

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +1

Query: 82  SIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           S + +   +D  +    P      G     GD TPV  +TP+   K SG G
Sbjct: 492 STLEEEQEEDTTITKVSPQPQERTGTAWGSGDATPVPLATPVNEYKVSGFG 542


>AF068708-4|AAC17755.1|  693|Caenorhabditis elegans P granule
           abnormality protein 3,isoform a protein.
          Length = 693

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +1

Query: 82  SIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           S + +   +D  +    P      G     GD TPV  +TP+   K SG G
Sbjct: 557 STLEEEQEEDTTITKVSPQPQERTGTAWGSGDATPVPLATPVNEYKVSGFG 607


>AC024844-8|AAK29951.1|  421|Caenorhabditis elegans Hypothetical
           protein Y65B4A.9 protein.
          Length = 421

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = +2

Query: 440 VHSSFKPINNAHFVVPVEIDGAVHQVYVL 526
           +H   KP   +HF +  EIDG  HQVY+L
Sbjct: 141 IHRDIKP---SHFCIGREIDGQHHQVYLL 166


>AB120729-1|BAC87886.1|  693|Caenorhabditis elegans PGL-3 protein.
          Length = 693

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +1

Query: 82  SIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           S + +   +D  +    P      G     GD TPV  +TP+   K SG G
Sbjct: 557 STLEEEQEEDTTITKVSPQPQERTGTAWGSGDATPVPLATPVNEYKVSGFG 607


>U88172-11|AAB42257.1|  390|Caenorhabditis elegans Hypothetical
           protein ZK354.2a protein.
          Length = 390

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 440 VHSSFKPINNAHFVVPVEIDGAVHQVYVL 526
           +H   KP   +HF +  E+DG  HQVY+L
Sbjct: 141 IHRDIKP---SHFCIGREVDGQHHQVYLL 166


>U88172-10|AAM97988.1|  437|Caenorhabditis elegans Hypothetical
           protein ZK354.2b protein.
          Length = 437

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 440 VHSSFKPINNAHFVVPVEIDGAVHQVYVL 526
           +H   KP   +HF +  E+DG  HQVY+L
Sbjct: 141 IHRDIKP---SHFCIGREVDGQHHQVYLL 166


>AF016426-1|AAB65347.2|  254|Caenorhabditis elegans Hypothetical
           protein W07B8.3 protein.
          Length = 254

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -1

Query: 565 AAPPQELVDMRPLQNVNLMDRTVDFYRHH 479
           + PP+   +M P ++ + MD   D YRHH
Sbjct: 109 SVPPERSYNMYPQRSPSSMDSAPDTYRHH 137


>U39852-7|AAK39260.1|  240|Caenorhabditis elegans Ground-like (grd
           related) protein 6 protein.
          Length = 240

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 13/36 (36%), Positives = 16/36 (44%)
 Frame = -3

Query: 236 PPVPLDFFPPKGVDPETGVPSPSLCCTPGDEPLSGP 129
           PP P  F PP  + P    P P + C P   P+  P
Sbjct: 58  PPCPAQFCPPPPICPPP--PPPPMPCPPPPPPMPRP 91


>AF067608-13|AAK95862.1| 1634|Caenorhabditis elegans Hypothetical
            protein B0511.12 protein.
          Length = 1634

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = -3

Query: 242  KKPPVPLDFFPPKGVDPETGVPSPSLCCTPGDEPL 138
            KKPP+P      +  D ETG  S +L  T    PL
Sbjct: 1578 KKPPIPPPNIRDRERDRETGTSSSALPTTTASNPL 1612


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,912,989
Number of Sequences: 27780
Number of extensions: 380580
Number of successful extensions: 1097
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1087
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).