SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL023844-11|CAA19525.3|  489|Caenorhabditis elegans Hypothetical...    31   1.00 
AF047651-12|AAN63460.1|  592|Caenorhabditis elegans Abnormal dau...    30   1.7  
AF047651-11|AAO61443.1|  446|Caenorhabditis elegans Abnormal dau...    30   1.7  
AF047651-10|AAC02726.1|  744|Caenorhabditis elegans Abnormal dau...    30   1.7  
L23110-1|AAA03544.1|  744|Caenorhabditis elegans BMP receptor pr...    29   3.0  
AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ...    27   3.3  
Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical pr...    29   4.0  
U88176-2|AAO91740.3|  550|Caenorhabditis elegans Hypothetical pr...    29   4.0  
U13019-10|AAC24442.1|  757|Caenorhabditis elegans Hypothetical p...    29   5.3  
Z83219-3|CAD57687.1|  965|Caenorhabditis elegans Hypothetical pr...    28   7.0  
Z81053-1|CAB02877.1|  385|Caenorhabditis elegans Hypothetical pr...    28   7.0  
U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical pr...    28   7.0  
Z83246-4|CAB05844.1|  414|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z75543-2|CAA99870.1|  529|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z73908-6|CAA98132.1|  414|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z46267-15|CAI79255.1| 1100|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-14|CAI79254.1| 1030|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-13|CAH04746.1|  845|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-12|CAD45595.2|  528|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-11|CAA86426.1|  611|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-10|CAA86425.1|  581|Caenorhabditis elegans Hypothetical p...    28   9.3  
Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z46267-8|CAA86424.2| 1030|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z46267-7|CAA86429.2|  947|Caenorhabditis elegans Hypothetical pr...    28   9.3  
Z46267-6|CAA86428.2| 1215|Caenorhabditis elegans Hypothetical pr...    28   9.3  

>AL023844-11|CAA19525.3|  489|Caenorhabditis elegans Hypothetical
           protein Y48A6B.10 protein.
          Length = 489

 Score = 31.1 bits (67), Expect = 1.00
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +1

Query: 499 AEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKTPQQHAD 657
           A+E+ D     + E++E  + V     R  KNR+ RE+KA  +A +  +Q A+
Sbjct: 351 ADESEDHEEAEEEEDKENEISVEEREARRAKNRKIREKKARKKAAQEARQAAE 403


>AF047651-12|AAN63460.1|  592|Caenorhabditis elegans Abnormal dauer
           formation protein4, isoform c protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -2

Query: 120 ADSRFFSILNKAHEWYLSIESAVCGEK 40
           A+ R F  LN+  +WY SI   VC EK
Sbjct: 198 AEKRIFDELNEYPKWYKSIVEFVCAEK 224


>AF047651-11|AAO61443.1|  446|Caenorhabditis elegans Abnormal dauer
           formation protein4, isoform d protein.
          Length = 446

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -2

Query: 120 ADSRFFSILNKAHEWYLSIESAVCGEK 40
           A+ R F  LN+  +WY SI   VC EK
Sbjct: 350 AEKRIFDELNEYPKWYKSIVEFVCAEK 376


>AF047651-10|AAC02726.1|  744|Caenorhabditis elegans Abnormal dauer
           formation protein4, isoform a protein.
          Length = 744

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -2

Query: 120 ADSRFFSILNKAHEWYLSIESAVCGEK 40
           A+ R F  LN+  +WY SI   VC EK
Sbjct: 350 AEKRIFDELNEYPKWYKSIVEFVCAEK 376


>L23110-1|AAA03544.1|  744|Caenorhabditis elegans BMP receptor
           protein.
          Length = 744

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -2

Query: 120 ADSRFFSILNKAHEWYLSIESAVCGEK 40
           A+ R F  LN+  +WY SI   VC EK
Sbjct: 350 AEKRIFDELNEYPKWYKSIVEFVCPEK 376


>AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical
            protein F59E12.9 protein.
          Length = 1621

 Score = 27.1 bits (57), Expect(2) = 3.3
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +3

Query: 771  VPPPAPPALEQEKRSPL 821
            +PPP PP   +EK++PL
Sbjct: 1389 LPPPPPPLPSEEKKNPL 1405



 Score = 20.6 bits (41), Expect(2) = 3.3
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 765  TGVPPPAPP 791
            T VPPP PP
Sbjct: 1353 TPVPPPPPP 1361


>Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical
           protein H39E23.3 protein.
          Length = 746

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = +1

Query: 469 ESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKTP 642
           ES     +A A+   D PP+ +  + E   PV     +P     D E+KAP +    P
Sbjct: 497 ESADSEKKAPAKREAD-PPKTESADSEKKAPVKREADKPKTESADSEKKAPAKREADP 553



 Score = 29.1 bits (62), Expect = 4.0
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = +1

Query: 469 ESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKTP 642
           ES     +A A+   D PP+ +  + E   PV     +P     D E+KAP +    P
Sbjct: 617 ESADSEKKAPAKREAD-PPKTESADSEKKAPVKREADKPKTESADSEKKAPAKREADP 673


>U88176-2|AAO91740.3|  550|Caenorhabditis elegans Hypothetical
           protein F18F11.4 protein.
          Length = 550

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +3

Query: 63  LSIDTIRALYSVLKKT*NRPTEVNFFDVNTV 155
           L ID+IR  Y V KK  +RP  V  FD+++V
Sbjct: 362 LEIDSIRYDYRVSKKMFHRPERVVHFDMHSV 392


>U13019-10|AAC24442.1|  757|Caenorhabditis elegans Hypothetical
           protein T12A2.2 protein.
          Length = 757

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 520 PPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAP 621
           P RP ++ EE  +P+       GKN++   R AP
Sbjct: 719 PNRPTVKSEEATIPIKGKKATQGKNKKGVIRPAP 752


>Z83219-3|CAD57687.1|  965|Caenorhabditis elegans Hypothetical
           protein C31C9.6 protein.
          Length = 965

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +3

Query: 774 PPPAPPALEQEKRSP 818
           PPP PPALEQE   P
Sbjct: 507 PPPPPPALEQEISGP 521


>Z81053-1|CAB02877.1|  385|Caenorhabditis elegans Hypothetical
           protein E02A10.2 protein.
          Length = 385

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%)
 Frame = -1

Query: 823 CNGDLFSCSKAGGAGGG-TPVLPPRTCHG 740
           C G    C   GG GGG  P  PP  C G
Sbjct: 92  CGGGGGGCGGGGGCGGGCAPPPPPPACGG 120


>U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical
           protein B0280.13 protein.
          Length = 616

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +3

Query: 774 PPPAPPALEQEKRSP 818
           PPP PPALEQE   P
Sbjct: 518 PPPPPPALEQEISGP 532


>Z83246-4|CAB05844.1|  414|Caenorhabditis elegans Hypothetical
           protein F53B2.6 protein.
          Length = 414

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 659 LSPQRSNSNKLQNNSRRSLLKRLFQK 736
           + P + +  K QN++RRS+  RLF +
Sbjct: 213 IEPAKKDHKKCQNSNRRSIFARLFSR 238


>Z75543-2|CAA99870.1|  529|Caenorhabditis elegans Hypothetical
           protein K01D12.2 protein.
          Length = 529

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 1/78 (1%)
 Frame = +2

Query: 587 VKTGGTGNGKHPRELIKHHNSMLTLSPQRSNSNKLQNNSRRSLLKRLFQK*SVAGPRR*H 766
           +K   TGN     E+  HH+S  T  P R   +  QN+   S+ +R  Q+  V      H
Sbjct: 255 LKNSVTGNNVQLEEI--HHSSKTTHHPLRVQHHLQQNSVHTSIAERTDQQPLVEPTSEIH 312

Query: 767 -GSATASATSLGTREEVA 817
             S+TA        E+ A
Sbjct: 313 LASSTAVEIKTNLNEKTA 330


>Z73908-6|CAA98132.1|  414|Caenorhabditis elegans Hypothetical
           protein F53B2.6 protein.
          Length = 414

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 659 LSPQRSNSNKLQNNSRRSLLKRLFQK 736
           + P + +  K QN++RRS+  RLF +
Sbjct: 213 IEPAKKDHKKCQNSNRRSIFARLFSR 238


>Z46267-15|CAI79255.1| 1100|Caenorhabditis elegans Hypothetical
           protein F49E2.5j protein.
          Length = 1100

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-14|CAI79254.1| 1030|Caenorhabditis elegans Hypothetical
           protein F49E2.5i protein.
          Length = 1030

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-13|CAH04746.1|  845|Caenorhabditis elegans Hypothetical
           protein F49E2.5h protein.
          Length = 845

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-12|CAD45595.2|  528|Caenorhabditis elegans Hypothetical
           protein F49E2.5g protein.
          Length = 528

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-11|CAA86426.1|  611|Caenorhabditis elegans Hypothetical
           protein F49E2.5f protein.
          Length = 611

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-10|CAA86425.1|  581|Caenorhabditis elegans Hypothetical
           protein F49E2.5e protein.
          Length = 581

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical
           protein F49E2.5d protein.
          Length = 889

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-8|CAA86424.2| 1030|Caenorhabditis elegans Hypothetical
           protein F49E2.5c protein.
          Length = 1030

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-7|CAA86429.2|  947|Caenorhabditis elegans Hypothetical
           protein F49E2.5b protein.
          Length = 947

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


>Z46267-6|CAA86428.2| 1215|Caenorhabditis elegans Hypothetical
           protein F49E2.5a protein.
          Length = 1215

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)
 Frame = +1

Query: 466 GESNKENIEAHAEEALDAPP-------RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP 624
           G+ NK+N +    EA  AP        +P +  EE         ++  KN+R  E +  P
Sbjct: 213 GKKNKKNKKKSESEATAAPASVEQVVEQPKVVTEEPHQQAAPQEKKNKKNKRKSESENVP 272

Query: 625 RAHKTP 642
            A +TP
Sbjct: 273 AASETP 278


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,992,964
Number of Sequences: 27780
Number of extensions: 374071
Number of successful extensions: 1458
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1448
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2029935014
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).