SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z29115-6|CAA82365.2| 1374|Caenorhabditis elegans Hypothetical pr...    30   2.1  
Z29115-5|CAA82366.2| 1368|Caenorhabditis elegans Hypothetical pr...    30   2.1  
Z19153-7|CAA79550.2| 1374|Caenorhabditis elegans Hypothetical pr...    30   2.1  
Z19153-6|CAA79551.2| 1368|Caenorhabditis elegans Hypothetical pr...    30   2.1  
AL031632-4|CAA21007.1|  451|Caenorhabditis elegans Hypothetical ...    30   2.7  
Z82073-6|CAB04924.1|  333|Caenorhabditis elegans Hypothetical pr...    29   4.8  
AF260242-1|AAF97548.1|  333|Caenorhabditis elegans palmitoyl-CoA...    29   4.8  
Z92789-8|CAB07222.3|  495|Caenorhabditis elegans Hypothetical pr...    29   6.3  
Z68336-9|CAA92741.3|  495|Caenorhabditis elegans Hypothetical pr...    29   6.3  
Z68012-1|CAA92016.1|  304|Caenorhabditis elegans Hypothetical pr...    29   6.3  
AC084197-23|AAM44389.1|  610|Caenorhabditis elegans Hypothetical...    28   8.4  

>Z29115-6|CAA82365.2| 1374|Caenorhabditis elegans Hypothetical protein
            C38C10.5b protein.
          Length = 1374

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 652  QWHPPRVWYSFHH*VLKQMNPPR 584
            QW+PP V  S+HH +  Q  PP+
Sbjct: 1352 QWNPPSVGQSYHHPLHHQQYPPQ 1374


>Z29115-5|CAA82366.2| 1368|Caenorhabditis elegans Hypothetical protein
            C38C10.5a protein.
          Length = 1368

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 652  QWHPPRVWYSFHH*VLKQMNPPR 584
            QW+PP V  S+HH +  Q  PP+
Sbjct: 1346 QWNPPSVGQSYHHPLHHQQYPPQ 1368


>Z19153-7|CAA79550.2| 1374|Caenorhabditis elegans Hypothetical protein
            C38C10.5b protein.
          Length = 1374

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 652  QWHPPRVWYSFHH*VLKQMNPPR 584
            QW+PP V  S+HH +  Q  PP+
Sbjct: 1352 QWNPPSVGQSYHHPLHHQQYPPQ 1374


>Z19153-6|CAA79551.2| 1368|Caenorhabditis elegans Hypothetical protein
            C38C10.5a protein.
          Length = 1368

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 652  QWHPPRVWYSFHH*VLKQMNPPR 584
            QW+PP V  S+HH +  Q  PP+
Sbjct: 1346 QWNPPSVGQSYHHPLHHQQYPPQ 1368


>AL031632-4|CAA21007.1|  451|Caenorhabditis elegans Hypothetical
           protein Y32B12B.5 protein.
          Length = 451

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +2

Query: 572 PCVVPWWIHLLQHL-MMKAIPDPWWMPLLISQSAKQISGTMELVC 703
           PC++P W+H++QH   + A      +  LI   A+Q+     L+C
Sbjct: 124 PCIMPLWLHVIQHAGFLFAQLTNGILVYLIVTKAQQLGTYRHLMC 168


>Z82073-6|CAB04924.1|  333|Caenorhabditis elegans Hypothetical
           protein W06D12.3 protein.
          Length = 333

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +1

Query: 691 GARLCSMYDSVAQPEESVFRECLLERCSVEENKIISGL 804
           GA +  +YD    PEE + R+C    C  E  K++  L
Sbjct: 295 GASIGMVYDRKTTPEEVIQRQCKKFGCETEREKMLHKL 332


>AF260242-1|AAF97548.1|  333|Caenorhabditis elegans palmitoyl-CoA
           fatty acid desaturaseFAT-5 protein.
          Length = 333

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +1

Query: 691 GARLCSMYDSVAQPEESVFRECLLERCSVEENKIISGL 804
           GA +  +YD    PEE + R+C    C  E  K++  L
Sbjct: 295 GASIGMVYDRKTTPEEVIQRQCKKFGCETEREKMLHKL 332


>Z92789-8|CAB07222.3|  495|Caenorhabditis elegans Hypothetical
           protein H02I12.8 protein.
          Length = 495

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +3

Query: 660 VNRRSKFPVQWSSFVFNVRFSGAT*GVCI 746
           +++R+  P+ W+SF++N+   G T   C+
Sbjct: 212 ISKRTNNPLMWNSFIYNLTEDGRTHEKCL 240


>Z68336-9|CAA92741.3|  495|Caenorhabditis elegans Hypothetical
           protein H02I12.8 protein.
          Length = 495

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +3

Query: 660 VNRRSKFPVQWSSFVFNVRFSGAT*GVCI 746
           +++R+  P+ W+SF++N+   G T   C+
Sbjct: 212 ISKRTNNPLMWNSFIYNLTEDGRTHEKCL 240


>Z68012-1|CAA92016.1|  304|Caenorhabditis elegans Hypothetical
           protein T24D5.1 protein.
          Length = 304

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +2

Query: 263 LRQFQTN-QRWILLNRSYQQMLKNGTLQITLLKPYPLTTLNLPHIDHLAPLYKVDFVKLK 439
           LR F T  +R + L +S  ++L +  + I  L+   L  L   + DH   LY +   K+K
Sbjct: 209 LRAFSTEVKRRVYLEKS--EVLDDQPIAIEFLE-LRLGQLLDGNDDHAVTLYTLMSNKIK 265

Query: 440 IKIHTIWMTCLIHLK 484
           I++ T+ ++ ++HL+
Sbjct: 266 IELDTVLLSLILHLE 280


>AC084197-23|AAM44389.1|  610|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.33 protein.
          Length = 610

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 19/45 (42%), Positives = 21/45 (46%)
 Frame = +1

Query: 268 AVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPS 402
           A S  P  D S S     A  W  A Y SQA  AY+ EPA   P+
Sbjct: 507 AASTGPSYDQS-SAAGGYAASW-DAYYASQAQSAYSAEPASTYPT 549


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,590,395
Number of Sequences: 27780
Number of extensions: 518933
Number of successful extensions: 1487
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1394
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1487
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2423194158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).