SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0007
         (818 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY314779-1|AAQ84886.1|  454|Caenorhabditis elegans secretin rece...    29   3.0  
AL031620-2|CAA20927.2|  454|Caenorhabditis elegans Hypothetical ...    29   3.0  
Z68334-1|CAA92727.1|  178|Caenorhabditis elegans Hypothetical pr...    28   7.0  

>AY314779-1|AAQ84886.1|  454|Caenorhabditis elegans secretin
           receptor-like proteinSEB-3 protein.
          Length = 454

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +3

Query: 390 CFY*CRQYSKNVKFLMSLCHDVVKCILIKLCYLCDSVMMYNL*VCIAIFKIFDVIVHSNL 569
           C     +Y++ ++    +C DV++ ++I +      V +  L   I +F IFD I    L
Sbjct: 89  CIKVVEEYAQCLQGFCRVCPDVLRDLVISVSLTLSFVSVILLVAAIVLFSIFDSIQCRRL 148

Query: 570 AIMK 581
           +I K
Sbjct: 149 SIHK 152


>AL031620-2|CAA20927.2|  454|Caenorhabditis elegans Hypothetical
           protein C18B12.2 protein.
          Length = 454

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +3

Query: 390 CFY*CRQYSKNVKFLMSLCHDVVKCILIKLCYLCDSVMMYNL*VCIAIFKIFDVIVHSNL 569
           C     +Y++ ++    +C DV++ ++I +      V +  L   I +F IFD I    L
Sbjct: 89  CIKVVEEYAQCLQGFCRVCPDVLRDLVISVSLTLSFVSVILLVAAIVLFSIFDSIQCRRL 148

Query: 570 AIMK 581
           +I K
Sbjct: 149 SIHK 152


>Z68334-1|CAA92727.1|  178|Caenorhabditis elegans Hypothetical
           protein C07H4.1 protein.
          Length = 178

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 18/64 (28%), Positives = 33/64 (51%)
 Frame = -3

Query: 534 KSQCILISYTSLRYHINNTV*LIYILQHHDTATLKTLHFSNIVYINKSSQECILT*NLME 355
           K+ CILI    + Y +   V L++ + HH  A   ++ F+ +  I  ++Q  IL   +++
Sbjct: 27  KNACILIGVLEVAYWVYYGVLLVFAIVHHQKAW--SVVFTGVNLIMLTAQVVILWVGVVK 84

Query: 354 ETVK 343
           E  K
Sbjct: 85  EAHK 88


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,511,708
Number of Sequences: 27780
Number of extensions: 322390
Number of successful extensions: 602
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 596
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 602
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2019417216
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).