SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40412-4|AAV28342.1|  618|Caenorhabditis elegans Hypothetical pr...    28   7.3  
Z92812-2|CAB07277.1|  213|Caenorhabditis elegans Hypothetical pr...    28   9.7  
Z68318-5|CAA92694.1|  418|Caenorhabditis elegans Hypothetical pr...    28   9.7  
AF026213-6|AAB71307.1|  655|Caenorhabditis elegans Temporarily a...    28   9.7  

>U40412-4|AAV28342.1|  618|Caenorhabditis elegans Hypothetical
           protein F46G11.1 protein.
          Length = 618

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = -1

Query: 246 FN-NVYQHLFIYLSNFLFLFYLINIVFFFF 160
           FN + Y H  +   N +  FY +NI F FF
Sbjct: 581 FNPSTYSHTVVEFPNVIIQFYFLNIFFCFF 610


>Z92812-2|CAB07277.1|  213|Caenorhabditis elegans Hypothetical
           protein T03E6.2 protein.
          Length = 213

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = -1

Query: 234 YQHLFIYLSNFLFLFYLINIVFFFFRYNN 148
           +  + +YL+  LFL   + + FFFF ++N
Sbjct: 97  FSTISLYLNRQLFLTLSLQVFFFFFNFSN 125


>Z68318-5|CAA92694.1|  418|Caenorhabditis elegans Hypothetical
           protein T21B10.4 protein.
          Length = 418

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +2

Query: 599 RTVTYASKRLNV---SCYLKLNRKILWQLSAQCSH*FYLHVARDDT 727
           +TV++  K+ ++   +  LKLN+KIL  L    SH  Y+  +  DT
Sbjct: 119 KTVSFVDKKKSLVPETSALKLNKKILSTLFDSTSHMLYVDFSTSDT 164


>AF026213-6|AAB71307.1|  655|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 123 protein.
          Length = 655

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -1

Query: 243 NNVYQHLFIYLSNFLFLFYLINIV 172
           N+++ H   Y+  FLFL YLI I+
Sbjct: 536 NSIWAHQTYYMFGFLFLVYLILII 559


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,428,761
Number of Sequences: 27780
Number of extensions: 346975
Number of successful extensions: 837
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 804
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 836
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2118983636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).