SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   293   6e-80
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       293   6e-80
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       293   6e-80
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   293   6e-80
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   293   6e-80
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   293   6e-80
Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   293   1e-79
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   293   1e-79
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       293   1e-79
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       287   7e-78
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   281   3e-76
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   151   6e-37
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   130   1e-30
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...   120   8e-28
U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical pr...    99   3e-21
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    92   4e-19
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    75   4e-14
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    75   4e-14
U42436-1|AAF99891.1|  305|Caenorhabditis elegans Hypothetical pr...    48   9e-06
U40426-4|AAP40527.1|  144|Caenorhabditis elegans Diacylglycerol ...    31   0.62 
U40426-3|AAP40528.1|  351|Caenorhabditis elegans Diacylglycerol ...    31   0.62 
U40426-2|AAP40526.1|  536|Caenorhabditis elegans Diacylglycerol ...    31   0.62 
Z48045-2|CAA88100.2|  967|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AF435952-1|AAL30828.1|  967|Caenorhabditis elegans Ser/Thr prote...    29   3.3  
Z30974-5|CAH19087.1| 3183|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z30974-4|CAA83226.2| 3767|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z30423-15|CAH19103.1| 3183|Caenorhabditis elegans Hypothetical p...    29   4.4  
Z30423-14|CAC42345.1| 3767|Caenorhabditis elegans Hypothetical p...    29   4.4  
AF139060-1|AAD29428.1| 3767|Caenorhabditis elegans transmembrane...    29   4.4  
Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr...    28   7.7  
U28741-1|AAA68325.2|  256|Caenorhabditis elegans Hypothetical pr...    28   7.7  
M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re...    28   7.7  
AL032654-9|CAA21720.1|  404|Caenorhabditis elegans Hypothetical ...    28   7.7  

>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 193 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 252

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 253 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 312

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 313 WISKQEYDESGPSIVHRKCF 332


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 223 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 282

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 283 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 342

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 343 WISKQEYDESGPSIVHRKCF 362


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  293 bits (720), Expect = 6e-80
 Identities = 135/140 (96%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  293 bits (718), Expect = 1e-79
 Identities = 134/140 (95%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  293 bits (718), Expect = 1e-79
 Identities = 134/140 (95%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  293 bits (718), Expect = 1e-79
 Identities = 134/140 (95%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  287 bits (703), Expect = 7e-78
 Identities = 133/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGME+ GIHET+YNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAP-TMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  281 bits (690), Expect = 3e-76
 Identities = 130/140 (92%), Positives = 134/140 (95%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQP+F+GME  GIHETTY SIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEVLFQPAFIGMEGAGIHETTYQSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGT+M+PGIADRMQKEI  LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTSMFPGIADRMQKEIQHLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  151 bits (365), Expect = 6e-37
 Identities = 69/140 (49%), Positives = 94/140 (67%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           ++ SY LPD   I I N  FR PE LF+P  +G E  G+      SIMKCDVD+R+ LY+
Sbjct: 235 VKSSYALPDTTKIEISNSLFRAPEVLFKPDLIGTEWPGMAHVVNQSIMKCDVDLRQTLYS 294

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTT++ G  DR+  E+  +AP+  KI+I A  ER    WIGGSI+ASL TF++M
Sbjct: 295 NIVLSGGTTLFKGFGDRLLGEMRKIAPADGKIRISASQERNSLTWIGGSIVASLDTFRKM 354

Query: 346 WISKQEYDESGPSIVHRKCF 287
           W+ K+EY++ G S +H++ F
Sbjct: 355 WLGKKEYEDMGASAMHKRFF 374


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  130 bits (313), Expect = 1e-30
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 13/144 (9%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L + Y LPDG+VI +G ERF  PE LFQP  + +E  G+ E  +  I   D+D R D Y 
Sbjct: 240 LSQQYTLPDGRVIRLGGERFEAPEILFQPHLINVEKAGLSELLFGCIQASDIDTRLDFYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGGTTMYPG+  R++KE+  L           A    KI+I APP RK+ V++GG+
Sbjct: 300 HIVLSGGTTMYPGLPSRLEKELKQLYLDRVLHGNTDAFQKFKIRIEAPPSRKHMVFLGGA 359

Query: 379 ILASL--STFQQMWISKQEYDESG 314
           +LA+L     Q  W+SK+EY+E G
Sbjct: 360 VLANLMKDRDQDFWVSKKEYEEGG 383


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score =  120 bits (290), Expect = 8e-28
 Identities = 60/143 (41%), Positives = 81/143 (56%), Gaps = 8/143 (5%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEA-----CGIHETTYNSIMKCDVDIRKDLY 530
           Y  P+G     G ER + PE LF   +L  E        + +    S    D+DIR  L+
Sbjct: 293 YAFPNGYTKEFGAERIKLPECLFDLGYLKAEGKKDGLMTVAQMAAASANLADIDIRPTLF 352

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLST 359
           +N  ++GG ++  G  +R+   +    P T+K+++ A P   ERKY  WIGGSIL SL T
Sbjct: 353 SNVTVTGGNSLILGFTERLNYALATKCPPTIKLRVFAAPTQAERKYGAWIGGSILGSLGT 412

Query: 358 FQQMWISKQEYDESGPSIVHRKC 290
           FQQMW+SK EYDESG SIV +KC
Sbjct: 413 FQQMWVSKAEYDESGKSIVEKKC 435


>U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical
           protein F42C5.9 protein.
          Length = 552

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 41/112 (36%), Positives = 73/112 (65%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           I N RF C E LF+P   G++  G+H+  + +I++C +D R+ LY N  L+GG ++ PGI
Sbjct: 428 IDNSRFLCTEGLFKPKKWGLDTKGLHQLIHEAILQCPIDSRRTLYRNIYLAGGASLMPGI 487

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
           A+++++E++ + P+T+  ++   P R  + ++G  I+AS STF+   IS Q+
Sbjct: 488 AEKLEQELSTVVPNTIHTQVNISPWRYNAAYLGAQIVASASTFEDSCISLQQ 539


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 51/139 (36%), Positives = 77/139 (55%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +G ERF  PE  F P F   E    I +T    I +C +D+R+ LY N VLSGG+TM+
Sbjct: 276 VDVGYERFLGPEIFFHPEFCNPEFTTPISDTIDTLIQQCPIDVRRGLYENIVLSGGSTMF 335

Query: 493 PGIADRMQKEITALA----------------PSTMKIKIIAPPERKYSVWIGGSILASLS 362
              A ++Q+++  L+                P  + +++I+   ++Y+VW GGS+LAS S
Sbjct: 336 KDFARKLQRDVKRLSDGRLQMSETLSGGRLKPKPIDVQVISHKMQRYAVWFGGSMLASTS 395

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K EY E GPSI
Sbjct: 396 EFYQVSHTKAEYMERGPSI 414


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I +G ERF  PE LF PS + ++ CG+ E    SI +C   +R  L  N ++ GG++ +P
Sbjct: 263 IHLGVERFAIPEILFNPSDIDIDQCGVAEAVIESICQCPEALRPALAENIIVIGGSSCFP 322

Query: 490 GIADRMQKEITALAPSTMKIKI---IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           G  +R+++E+ ++ P+   + +   +  P+     W  G  L  L+  +  WI+++++DE
Sbjct: 323 GFRERLEREVRSMLPAEYGLNVSNDVINPQT--HSWHCGQEL--LTASKVPWINRKDWDE 378

Query: 319 SGPSIVHRKCF*T 281
            G S+     F T
Sbjct: 379 RGDSLEFSNFFQT 391


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I +G ERF  PE LF PS + ++ CG+ E    SI +C   +R  L  N ++ GG++ +P
Sbjct: 263 IHLGVERFAIPEILFNPSDIDIDQCGVAEAVIESICQCPEALRPALAENIIVIGGSSCFP 322

Query: 490 GIADRMQKEITALAPSTMKIKI---IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           G  +R+++E+ ++ P+   + +   +  P+     W  G  L  L+  +  WI+++++DE
Sbjct: 323 GFRERLEREVRSMLPAEYGLNVSNDVINPQT--HSWHCGQEL--LTASKVPWINRKDWDE 378

Query: 319 SGPSIVHRKCF*T 281
            G S+     F T
Sbjct: 379 RGDSLEFSNFFQT 391


>U42436-1|AAF99891.1|  305|Caenorhabditis elegans Hypothetical
           protein C49H3.8 protein.
          Length = 305

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 10/91 (10%)
 Frame = -3

Query: 568 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL-APSTMKIKIIAP----PERK 404
           + KC +D+RK L+ N +L+GG +  PG+  R+++EI  +   +  KI +I       E K
Sbjct: 198 VSKCPIDLRKKLFPNILLTGGVSTIPGLMKRLEQEIQVIDEKNNSKIAVIVKFYQFSEIK 257

Query: 403 ----YSVWIGGSILASL-STFQQMWISKQEY 326
               +  W+G S+L SL  T ++  ++ +E+
Sbjct: 258 NTPLFVSWLGASLLGSLRETIERKSLTLEEW 288


>U40426-4|AAP40527.1|  144|Caenorhabditis elegans Diacylglycerol
           kinase protein 2,isoform b protein.
          Length = 144

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +2

Query: 392 PYGVLPLWRSNDLNLHCRWGESCD 463
           P  VLPL   NDL+   +WG+ CD
Sbjct: 97  PVAVLPLGTGNDLSRLLKWGKKCD 120


>U40426-3|AAP40528.1|  351|Caenorhabditis elegans Diacylglycerol
           kinase protein 2,isoform c protein.
          Length = 351

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +2

Query: 392 PYGVLPLWRSNDLNLHCRWGESCD 463
           P  VLPL   NDL+   +WG+ CD
Sbjct: 97  PVAVLPLGTGNDLSRLLKWGKKCD 120


>U40426-2|AAP40526.1|  536|Caenorhabditis elegans Diacylglycerol
           kinase protein 2,isoform a protein.
          Length = 536

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +2

Query: 392 PYGVLPLWRSNDLNLHCRWGESCD 463
           P  VLPL   NDL+   +WG+ CD
Sbjct: 282 PVAVLPLGTGNDLSRLLKWGKKCD 305


>Z48045-2|CAA88100.2|  967|Caenorhabditis elegans Hypothetical
           protein C41C4.4 protein.
          Length = 967

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%)
 Frame = -2

Query: 704 REVLRTSRRSGHHYRK--RKIPLPRGSLPTLVLGYGSLRHPR 585
           R++LR  R   HHYR+    +    G +P   L Y + R PR
Sbjct: 844 RDLLRAMRNKKHHYRELPEDVRQSLGDIPDQFLHYFTSRFPR 885


>AF435952-1|AAL30828.1|  967|Caenorhabditis elegans Ser/Thr protein
           kinase protein.
          Length = 967

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%)
 Frame = -2

Query: 704 REVLRTSRRSGHHYRK--RKIPLPRGSLPTLVLGYGSLRHPR 585
           R++LR  R   HHYR+    +    G +P   L Y + R PR
Sbjct: 844 RDLLRAMRNKKHHYRELPEDVRQSLGDIPDQFLHYFTSRFPR 885


>Z30974-5|CAH19087.1| 3183|Caenorhabditis elegans Hypothetical protein
            K08E5.3b protein.
          Length = 3183

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 662  RKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRG 549
            RKR+  LPRG++ T   G    RHP   I L +E   G
Sbjct: 994  RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTG 1031


>Z30974-4|CAA83226.2| 3767|Caenorhabditis elegans Hypothetical protein
            K08E5.3a protein.
          Length = 3767

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 662  RKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRG 549
            RKR+  LPRG++ T   G    RHP   I L +E   G
Sbjct: 1578 RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTG 1615


>Z30423-15|CAH19103.1| 3183|Caenorhabditis elegans Hypothetical
            protein K08E5.3b protein.
          Length = 3183

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 662  RKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRG 549
            RKR+  LPRG++ T   G    RHP   I L +E   G
Sbjct: 994  RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTG 1031


>Z30423-14|CAC42345.1| 3767|Caenorhabditis elegans Hypothetical
            protein K08E5.3a protein.
          Length = 3767

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 662  RKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRG 549
            RKR+  LPRG++ T   G    RHP   I L +E   G
Sbjct: 1578 RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTG 1615


>AF139060-1|AAD29428.1| 3767|Caenorhabditis elegans transmembrane cell
            adhesion receptorMUA-3 precursor protein.
          Length = 3767

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 662  RKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRG 549
            RKR+  LPRG++ T   G    RHP   I L +E   G
Sbjct: 1578 RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTG 1615


>Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical protein
            F29D11.1 protein.
          Length = 4753

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 228  KPELSSRPRAAGGSDARCV*KHFLCTMEGPD 320
            +P  + R  A GG DA+C+ K + C  E PD
Sbjct: 3624 EPNCTERQFACGGDDAKCIPKLWYCDGE-PD 3653


>U28741-1|AAA68325.2|  256|Caenorhabditis elegans Hypothetical
           protein F35D2.3 protein.
          Length = 256

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = -3

Query: 331 EYDESGPSIVHRKCF*THRASLPPAARGRLLNSG 230
           +Y ++G SIV+ KC  T R   P   R R LN G
Sbjct: 30  DYCKNGGSIVNGKCECTLRYEGPQCERERCLNGG 63


>M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-related
            protein protein.
          Length = 4753

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 228  KPELSSRPRAAGGSDARCV*KHFLCTMEGPD 320
            +P  + R  A GG DA+C+ K + C  E PD
Sbjct: 3624 EPNCTERQFACGGDDAKCIPKLWYCDGE-PD 3653


>AL032654-9|CAA21720.1|  404|Caenorhabditis elegans Hypothetical
           protein Y52B11A.9 protein.
          Length = 404

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 412 ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*THRASLPPAAR 251
           +RK  V   G   A +S F    + K++ DE GPS   RK       S  PAA+
Sbjct: 213 DRKLDVK-SGVASAKISIFDMPKVKKEDPDEPGPSQPSRKSGKKRSRSRSPAAK 265


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,567,587
Number of Sequences: 27780
Number of extensions: 356008
Number of successful extensions: 1011
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 974
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1003
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1676746902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).