SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF077545-1|AAC26306.2|  506|Caenorhabditis elegans Hypothetical ...    28   7.4  
Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical pr...    27   9.8  
U39999-6|AAA81107.2|  198|Caenorhabditis elegans Hypothetical pr...    27   9.8  

>AF077545-1|AAC26306.2|  506|Caenorhabditis elegans Hypothetical
           protein H41C03.3 protein.
          Length = 506

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 14/40 (35%), Positives = 16/40 (40%)
 Frame = +3

Query: 378 CSANVSVSPRMRCTDSAAHKCNXELFNRNNFSIRYWSWNY 497
           C  NV + P     DSA H  N   +N     I    WNY
Sbjct: 211 CLPNVLLLPDEESVDSAGHNINLAHYNCLRVLINKPGWNY 250


>Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical
           protein R13H4.8 protein.
          Length = 212

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 9/17 (52%), Positives = 9/17 (52%)
 Frame = -3

Query: 465 CCG*KARSCICAPRCRC 415
           CCG     C C PRC C
Sbjct: 79  CCGCGCGCCCCRPRCCC 95


>U39999-6|AAA81107.2|  198|Caenorhabditis elegans Hypothetical
           protein F41G3.10 protein.
          Length = 198

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 370 RRYAPQTCQYHRGCGAPTARRTNATXSFL 456
           R+  P+TC Y  G G  T  RT+ T + L
Sbjct: 130 RQQCPRTCGYCSGSGVVTTTRTSTTCADL 158


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,288,819
Number of Sequences: 27780
Number of extensions: 309989
Number of successful extensions: 656
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 650
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).