SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   189   2e-48
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   189   2e-48
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   189   2e-48
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       189   2e-48
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       189   2e-48
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       189   2e-48
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       189   2e-48
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   189   2e-48
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   189   2e-48
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   189   2e-48
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   184   4e-47
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   128   4e-30
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   115   2e-26
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   115   2e-26
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   114   5e-26
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   114   5e-26
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   108   4e-24
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    99   2e-21
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    70   1e-12
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    38   0.008
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    38   0.008
Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical pr...    31   0.86 
AF067942-3|AAL11486.1|  351|Caenorhabditis elegans Hypothetical ...    29   2.0  
Z82277-1|CAB05248.1|  648|Caenorhabditis elegans Hypothetical pr...    29   2.6  
Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical pr...    29   2.6  
U12921-1|AAB60256.1|  648|Caenorhabditis elegans sex determinati...    29   2.6  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    28   4.6  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    28   4.6  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    28   4.6  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    28   4.6  
U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical pr...    28   6.1  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   6.1  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHTVPI 166



 Score =  114 bits (274), Expect = 5e-26
 Identities = 51/53 (96%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHTVPI 166



 Score =  112 bits (270), Expect = 2e-25
 Identities = 49/53 (92%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 5   GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 64

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 65  APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 122


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 35  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 94

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 95  APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 152



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = +1

Query: 148 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 39


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  189 bits (460), Expect = 2e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGD-GVTHTVPI 166



 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  184 bits (448), Expect = 4e-47
 Identities = 83/91 (91%), Positives = 86/91 (94%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APLNPK+NREKMTQIMFETFNTPAMYV IQA
Sbjct: 108 APLNPKSNREKMTQIMFETFNTPAMYVNIQA 138



 Score =  109 bits (261), Expect = 2e-24
 Identities = 49/51 (96%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52



 Score = 35.1 bits (77), Expect = 0.040
 Identities = 16/17 (94%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VLSLYASGRTTGIVLD
Sbjct: 138 AVLSLYASGRTTGIVLD 154


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  128 bits (308), Expect = 4e-30
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 2/126 (1%)
 Frame = +3

Query: 237 GTEG-LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLL 410
           G +G + +G +A+S RG+ +++YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLL
Sbjct: 50  GLDGDIFIGPKAESNRGLFSIEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLL 109

Query: 411 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCP 590
           T+APLNP  NRE+  +I FETFN PA+Y+ +QA                SGD G+ H  P
Sbjct: 110 TDAPLNPLKNRERSAEIFFETFNVPALYIQMQAVLSLYATGRTTGVVLDSGD-GVTHAVP 168

Query: 591 ILRKGF 608
           I+ KGF
Sbjct: 169 IV-KGF 173



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 21/39 (53%), Positives = 29/39 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAG 49


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 33/38 (86%), Positives = 34/38 (89%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 350
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  115 bits (277), Expect = 2e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 33/38 (86%), Positives = 34/38 (89%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 350
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  114 bits (274), Expect = 5e-26
 Identities = 51/53 (96%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 33/38 (86%), Positives = 34/38 (89%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 350
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  114 bits (274), Expect = 5e-26
 Identities = 51/53 (96%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53



 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 30/35 (85%), Positives = 31/35 (88%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDM 341
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDM
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  108 bits (259), Expect = 4e-24
 Identities = 57/130 (43%), Positives = 79/130 (60%), Gaps = 1/130 (0%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEH 398
           R G    + L+VG+E    R +L + YP+++GIV NWDDM  +W HTF  E L + P+E 
Sbjct: 46  RVGNIEIKDLMVGEECSQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKEC 105

Query: 399 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLP 578
            +LLTE PLNP +NREKM Q+MFE +   ++YVA+QA        +       SGD G+ 
Sbjct: 106 KLLLTEPPLNPNSNREKMFQVMFEQYGFNSIYVAVQAVLTLYAQGLLTGVVVDSGD-GVT 164

Query: 579 HPCPILRKGF 608
           H CP+  +GF
Sbjct: 165 HICPVY-EGF 173



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +VVDNG+G  K G+AG + P  +FPS+VGRP
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRP 39


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 VGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           +GDEA S      T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLTE PLN 
Sbjct: 67  IGDEALSPAATNYTVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNT 126

Query: 432 KANREKMTQIMFETFNTPAMYVAIQA 509
             NRE   +IMFE+FN P +Y+A+QA
Sbjct: 127 PENREYTAEIMFESFNVPGLYIAVQA 152



 Score = 36.7 bits (81), Expect = 0.013
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 486 AMYVAIQACSRC 521
           A Y++      C
Sbjct: 154 AYYLSKNVVLSC 165



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 261 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 440
           +E   K  +  ++ PIE G V NWD  ++IW  TF   + V      + LT+      A 
Sbjct: 49  EECSDKFSLFYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPAL 106

Query: 441 REKMTQIMFETF 476
            +  ++I+F+ F
Sbjct: 107 PDVSSEILFDYF 118


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 261 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 440
           +E   K  +  ++ PIE G V NWD  ++IW  TF   + V      + LT+      A 
Sbjct: 49  EECSDKFSLFYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPAL 106

Query: 441 REKMTQIMFETF 476
            +  ++I+F+ F
Sbjct: 107 PDVSSEILFDYF 118


>Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical
           protein C27H2.2a protein.
          Length = 906

 Score = 30.7 bits (66), Expect = 0.86
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 4/52 (7%)
 Frame = -1

Query: 355 CQIFSMSSQLVTIPC-SMGYLRVRIP---LLLCASSPTKSPSVPYRPSRPDG 212
           CQ+FS   QLVT+   SMG +++++    L L AS  +  P++   P   DG
Sbjct: 251 CQLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLLASKSSTKPTIAPNPPEIDG 302


>AF067942-3|AAL11486.1|  351|Caenorhabditis elegans Hypothetical
           protein ZK6.7b protein.
          Length = 351

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 3/41 (7%)
 Frame = -2

Query: 612 GGIPFVKWGTGVEDPRRRKSSTIPVVRPDAYSES---TLGW 499
           GG+P   WGT     +  +S+T+P+ R   ++ +    +GW
Sbjct: 301 GGVPAYDWGTKTNKKKYGQSTTLPLSREPRFTSTGVMPIGW 341


>Z82277-1|CAB05248.1|  648|Caenorhabditis elegans Hypothetical
           protein LLC1.1 protein.
          Length = 648

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +2

Query: 470 NIQHARHVRRHPSVLSLYASGRTTGIVLDFRRRGSSTPVP 589
           N Q+  H   HP  +S YASGR+  + L    RG    +P
Sbjct: 446 NRQYRVHTAMHPIAISDYASGRSVYLHLQSLPRGRYLLIP 485


>Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical
           protein M110.1 protein.
          Length = 499

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 15/29 (51%), Positives = 17/29 (58%)
 Frame = +3

Query: 198 RGKAPPSGRDGRYGTEGLLVGDEAQSKRG 284
           RGKA  +GRDGR G EG       Q +RG
Sbjct: 216 RGKAGHTGRDGRPGLEGTPGTRGVQGERG 244


>U12921-1|AAB60256.1|  648|Caenorhabditis elegans sex determination
           protein.
          Length = 648

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +2

Query: 470 NIQHARHVRRHPSVLSLYASGRTTGIVLDFRRRGSSTPVP 589
           N Q+  H   HP  +S YASGR+  + L    RG    +P
Sbjct: 446 NRQYRVHTAMHPIAISDYASGRSVYLHLQSLPRGRYLLIP 485


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
            beta protein.
          Length = 1418

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 377  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 502
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1230 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1274



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 173 ASSPAKPALHIPEPLSTTNAATSS 102
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
            beta homolog EGL-8 protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 377  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 502
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 173 ASSPAKPALHIPEPLSTTNAATSS 102
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
            defective protein 8,isoform a protein.
          Length = 1419

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 377  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 502
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1231 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1275



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 173 ASSPAKPALHIPEPLSTTNAATSS 102
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
            defective protein 8,isoform b protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 377  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 502
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -3

Query: 173 ASSPAKPALHIPEPLSTTNAATSS 102
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical
           protein F42C5.9 protein.
          Length = 552

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 491 VRRHPSVLSLYASGRTTGIVLDFRRRGSSTPV 586
           + R PS++ LYA   TTG+V+D   R +  PV
Sbjct: 307 ITRQPSLI-LYAYDVTTGVVVDIGERVNIVPV 337


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +1

Query: 148 KAGFAGDDAPRAVFPSIVGRPRHQG 222
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,279,035
Number of Sequences: 27780
Number of extensions: 385181
Number of successful extensions: 1530
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1515
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1332243108
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).