SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0038
         (638 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81522-2|CAB04238.1|  415|Caenorhabditis elegans Hypothetical pr...    28   6.5  
U88172-6|AAB42261.1|  310|Caenorhabditis elegans Hypothetical pr...    27   8.6  

>Z81522-2|CAB04238.1|  415|Caenorhabditis elegans Hypothetical
           protein F32B4.1 protein.
          Length = 415

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = -3

Query: 189 MRLYSAMFFYLIFFTLFQVVFSLQWKAH*K 100
           MRL+++  ++LIF+ L  V   +Q++ H K
Sbjct: 1   MRLHASNMYFLIFYVLITVFLFVQFQKHTK 30


>U88172-6|AAB42261.1|  310|Caenorhabditis elegans Hypothetical
           protein ZK354.9 protein.
          Length = 310

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/42 (30%), Positives = 25/42 (59%)
 Frame = -1

Query: 620 LHINKPTLQTLPVLNSVKDKFDSNPPNLLSIHL*ISNRYNYE 495
           +++N   LQ +  L ++K  FD+  PN L+I +  S+  N++
Sbjct: 174 INLNFLQLQNVSQLRAIKRPFDNPEPNTLAIDILWSDPTNFQ 215


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,556,745
Number of Sequences: 27780
Number of extensions: 297266
Number of successful extensions: 656
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 640
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 656
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1416829972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).