SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U49941-8|AAB53876.1| 2427|Caenorhabditis elegans Spectrin protei...   101   5e-22
Z81570-7|CAB04608.2| 4063|Caenorhabditis elegans Hypothetical pr...    59   2e-09
Z75956-5|CAB00130.2| 4063|Caenorhabditis elegans Hypothetical pr...    59   2e-09
AF053496-1|AAC08577.1| 4063|Caenorhabditis elegans beta chain sp...    59   2e-09
U64854-2|AAK77611.1| 2257|Caenorhabditis elegans Uncoordinated p...    51   6e-07
U64854-1|AAK77612.2| 2302|Caenorhabditis elegans Uncoordinated p...    51   6e-07
AF261891-1|AAF72996.1| 2257|Caenorhabditis elegans beta-spectrin...    51   6e-07
AF166170-1|AAD49859.1| 2257|Caenorhabditis elegans beta-G spectr...    51   6e-07
AF166169-1|AAD49858.1| 2302|Caenorhabditis elegans beta-G spectr...    51   6e-07
Z75552-2|CAA99944.1|  894|Caenorhabditis elegans Hypothetical pr...    33   0.21 
Z75552-1|CAA99941.1|  920|Caenorhabditis elegans Hypothetical pr...    33   0.21 
Z68104-1|CAA92112.1|  866|Caenorhabditis elegans Hypothetical pr...    31   0.48 
U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily ass...    30   1.1  
U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass...    30   1.1  
L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical pr...    30   1.5  
Z69792-5|CAA93668.3| 1410|Caenorhabditis elegans Hypothetical pr...    29   1.9  
U13643-2|AAN65298.1|  354|Caenorhabditis elegans Hypothetical pr...    29   1.9  
U13643-1|AAA21083.1|  427|Caenorhabditis elegans Hypothetical pr...    29   1.9  
AL022270-3|CAB63434.2| 1410|Caenorhabditis elegans Hypothetical ...    29   1.9  
Z71186-8|CAA94917.2| 1322|Caenorhabditis elegans Hypothetical pr...    29   2.6  
U55369-5|AAM29663.2| 1046|Caenorhabditis elegans Hypothetical pr...    29   2.6  
U55369-4|AAM29662.1| 1022|Caenorhabditis elegans Hypothetical pr...    29   2.6  
AF100306-1|AAC68921.1|  423|Caenorhabditis elegans Hypothetical ...    29   3.4  
AC087232-1|AAK09079.2|  574|Caenorhabditis elegans Hypothetical ...    28   5.9  
U23511-13|AAC46800.1|  770|Caenorhabditis elegans Hypothetical p...    27   7.8  
AC006708-24|AAF60413.1|  660|Caenorhabditis elegans Hypothetical...    27   7.8  

>U49941-8|AAB53876.1| 2427|Caenorhabditis elegans Spectrin protein 1
           protein.
          Length = 2427

 Score =  101 bits (241), Expect = 5e-22
 Identities = 43/70 (61%), Positives = 58/70 (82%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL+EA  +QQ+NR +ED+E WLSE+EGQ+ SEDYGKDL SVQNLQKK  L+E+D ++
Sbjct: 687 KGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNA 746

Query: 69  HAERIDAIRE 40
           H +R+D I++
Sbjct: 747 HNDRVDGIKQ 756



 Score = 87.4 bits (207), Expect = 7e-18
 Identities = 37/84 (44%), Positives = 58/84 (69%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A DDSYLDPTN+ GK+QKH NFEQEL+AN+ R+D+I + G+++++  HFA   I  R+ +
Sbjct: 613 ARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQ 672

Query: 290 LGGIWERLVQSSS*RETSCRKRLN 219
           +  +W  LV +++ +    R+  N
Sbjct: 673 VNNLWNELVDATNKKGAKLREAGN 696



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 38/70 (54%), Positives = 52/70 (74%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  +L+EA +Q+ +  AV+D+E WL EVE  L SEDYGKDL SV+NL KKH+LLEAD+ +
Sbjct: 1607 KSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVA 1666

Query: 69   HAERIDAIRE 40
            H +R+  + E
Sbjct: 1667 HQDRVGEMNE 1676



 Score = 64.9 bits (151), Expect = 4e-11
 Identities = 25/68 (36%), Positives = 43/68 (63%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A ++++ DP+NL  K+QKH+ FE E+QA+   +  +   G  +++  HFA   I  R+EE
Sbjct: 84  AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 143

Query: 290 LGGIWERL 267
           L  +W++L
Sbjct: 144 LHALWDKL 151



 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 24/70 (34%), Positives = 45/70 (64%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            +KL +A    Q+ R ++D E W+ E +  + S+DYG+DL  VQNL++KH  ++ +++SH 
Sbjct: 1715 DKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHE 1774

Query: 63   ERIDAIREPG 34
             ++  ++  G
Sbjct: 1775 PQVSLVKLKG 1784



 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 26/72 (36%), Positives = 47/72 (65%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L  A + Q+++R V++   W+ E +  L SED+G+DL SVQ LQ+KH  +E D+
Sbjct: 1182 EQREQQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDL 1241

Query: 75   SSHAERIDAIRE 40
            ++  ++I ++ E
Sbjct: 1242 AALGDKIKSLDE 1253



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/53 (41%), Positives = 35/53 (66%)
 Frame = -3

Query: 228 AAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           A Q Q++NR  ++   W+ E +  L S+DYG+DL +VQ LQ+KH   E D+++
Sbjct: 271 AHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 323



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 26/70 (37%), Positives = 40/70 (57%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E+ Q  Q  R +ED   W+ E E    S + G+DL  VQNL KK   L A++
Sbjct: 791  EKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEI 850

Query: 75   SSHAERIDAI 46
            ++H  +I+++
Sbjct: 851  ANHDSQIESV 860



 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query: 267  GAVFELKGNK---LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
            G + +L GN+   L E+   Q +   VE+ E W++E +  L S+++G+++  VQ L KKH
Sbjct: 1813 GQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKH 1872

Query: 96   ALLEADVSSHAERI 55
               + D+  H +R+
Sbjct: 1873 DTFQVDLELHKQRV 1886



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 25/84 (29%), Positives = 42/84 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L ++ Q  QY     + + W+SE E  + S DYGKD  S + L KKH  L +D+
Sbjct: 897  EKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDL 956

Query: 75   SSHAERIDAIREPGRASS*KREPL 4
             +    I+ +R+       + +P+
Sbjct: 957  EAFKGTIEDLRKQASQCKYQEQPM 980



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 23/69 (33%), Positives = 44/69 (63%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+   QQ++R  ++IE W++E + Q+  E+  +D T++Q   +K    EA++ ++++
Sbjct: 1503 KLGESQTLQQFSRDADEIENWMTE-KFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSD 1561

Query: 60   RIDAIREPG 34
            RI AI + G
Sbjct: 1562 RIAAIIQAG 1570



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KLQ+A +   + R  ++I  W+ E E  + +ED G DL  V+ LQ+K      ++ +
Sbjct: 158 KGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGN 217

Query: 69  HAERIDAIRE 40
           H  RI+ I +
Sbjct: 218 HQYRINEINQ 227



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/76 (30%), Positives = 45/76 (59%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           + K ++L+EA Q Q + R  +++ +W+ E + Q   E+  +D +++Q   +KH   EA+V
Sbjct: 51  QTKRDRLEEARQFQYFKRDADELNVWILE-KLQTAQEENFRDPSNLQAKIQKHEAFEAEV 109

Query: 75  SSHAERIDAIREPGRA 28
            +HA+ I  + + G A
Sbjct: 110 QAHAKTIANLDKTGNA 125



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 21/65 (32%), Positives = 36/65 (55%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           ++    Q + R  E  E W+++ E  L + D G  L SV++L KKH   E  +++  E+I
Sbjct: 481 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 540

Query: 54  DAIRE 40
           +A+ E
Sbjct: 541 NALDE 545



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            KL++ +   Q+    + +E W++E E Q+ SED+G+DL+SVQ L  K    +A +++   
Sbjct: 1931 KLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEH 1990

Query: 63   ERIDAIRE 40
            E I  I E
Sbjct: 1991 EGIQRITE 1998



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 19/72 (26%), Positives = 41/72 (56%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +GN L+E+ ++Q ++R  +++  W++E       + Y  D T+++   +KH   E ++ +
Sbjct: 582 RGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA 640

Query: 69  HAERIDAIREPG 34
           +  R+D IR  G
Sbjct: 641 NENRLDDIRSTG 652



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL+EA +  Q  R   D+  W+   E     ++ G DL  V+ LQKK    + D+
Sbjct: 1075 ETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDL 1134

Query: 75   SSHAERIDAIRE 40
             ++  R+  + +
Sbjct: 1135 KANEVRLQEMNQ 1146



 Score = 33.9 bits (74), Expect = 0.090
 Identities = 11/46 (23%), Positives = 29/46 (63%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + +++ +     +L++ +H+A   ++ R + L
Sbjct: 523 IKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAERRQAL 568



 Score = 33.9 bits (74), Expect = 0.090
 Identities = 20/83 (24%), Positives = 41/83 (49%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D  ++   ++KH   E ++ A++ RV E+      LLE + F   QI+ R + +
Sbjct: 1640 SEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLI 1699

Query: 287  GGIWERLVQSSS*RETSCRKRLN 219
               ++ + + ++ R     K LN
Sbjct: 1700 ADRYDGVKKMATDRRDKLSKALN 1722



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA---QPQISSR 300
            ++DD   D   +    +KH+  + EL +++P+V  +   G+ LL     A   + QI  R
Sbjct: 1745 SSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKR 1804

Query: 299  VEELGGIWERL 267
            +E+L   W ++
Sbjct: 1805 MEDLEQSWGQI 1815



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 14/69 (20%), Positives = 32/69 (46%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ +   + S++   D+T  + L ++H     ++ S A 
Sbjct: 1293 KLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAA 1352

Query: 60   RIDAIREPG 34
               A  + G
Sbjct: 1353 TFQAFDQFG 1361



 Score = 30.7 bits (66), Expect = 0.84
 Identities = 13/70 (18%), Positives = 32/70 (45%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++K Q    E+  +  +++ +++    +++  HF  P+I  ++ +L   W  
Sbjct: 832  DLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRI 891

Query: 269  LVQSSS*RET 240
            L   +  R T
Sbjct: 892  LKSKAEKRRT 901



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A++D   D  ++    +K    E +  A+  RVD I  + ++  E EHF  P I  + E 
Sbjct: 719 ASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQEN 778

Query: 290 L 288
           L
Sbjct: 779 L 779



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 12/52 (23%), Positives = 23/52 (44%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T     +++HQ +  E+ +           G +LL   H+A   I +R++
Sbjct: 1329 DVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 1380



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 12/59 (20%), Positives = 29/59 (49%)
 Frame = -1

Query: 464 DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           D+   D       ++ HQ  + E+ A     ++  + G++L+E+     P++  ++E+L
Sbjct: 404 DELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKL 462


>Z81570-7|CAB04608.2| 4063|Caenorhabditis elegans Hypothetical protein
            R31.1 protein.
          Length = 4063

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D+S+LD TNL  K+QKH  F+ EL  N+ R+  +   G++L+   HF   Q+ +++
Sbjct: 2749 QLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL 2808

Query: 296  EELGGIWERLVQSSS 252
             EL   W+ L   S+
Sbjct: 2809 VELRSGWDELRTKSA 2823



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 27/74 (36%), Positives = 46/74 (62%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            LK  +L+EA +     R VEDIE WL +VEG+L S+D+G+D+ S + L KK   L+ +++
Sbjct: 2824 LKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIA 2883

Query: 72   SHAERIDAIREPGR 31
              ++ +  + +  R
Sbjct: 2884 GRSDAVVEMMKKAR 2897



 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 27/73 (36%), Positives = 46/73 (63%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L++AA Q+  +R +ED    L E++  L S+D G DL SV++L +KHA+LE ++  
Sbjct: 1446 KGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGL 1505

Query: 69   HAERIDAIREPGR 31
            +  ++  I   G+
Sbjct: 1506 YGNKLSDIENRGK 1518



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DDS L P+ +  ++ KH+ FE E+ AN+PR+ +I + G  L+  +H+  P +   V ++ 
Sbjct: 1374 DDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVN 1433

Query: 284  GIW 276
              W
Sbjct: 1434 AQW 1436



 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  A +   +NR VED +  + E    + S+DYGKD  SV+ L +K + LE D+S+  +
Sbjct: 2405 ELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQ 2464

Query: 60   RIDAIREPGRASS*KREPL 4
            ++ A  +  +    KR PL
Sbjct: 2465 KLIAHDKDAQKILEKRPPL 2483



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 246 GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           GN L EA   QQY +   + E W+ E    + S+D G+D  + ++L ++HA LE ++ ++
Sbjct: 730 GNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY 789

Query: 66  AERIDAIRE 40
              I  + E
Sbjct: 790 KSDISRLEE 798



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            ++QQY     ++E W++E    L SEDYG D  + + L  KH  L  D++++ + ++ +
Sbjct: 1667 KEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++Q HQ  E E+ ANKP VD+I   G +L  L     P+I++R +EL   W +L
Sbjct: 2238 RLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQL 2289



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 17/63 (26%), Positives = 31/63 (49%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D  +    V++H  +  E+Q  KP VD+    G+R+++  H    +I  +V+ L   W  
Sbjct: 3398 DVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAM 3457

Query: 269  LVQ 261
            L +
Sbjct: 3458 LCE 3460



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/66 (25%), Positives = 38/66 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            ++ +A++  ++ R  +D+  WL E E    +EDYG+DL   Q + ++      ++++  E
Sbjct: 3146 QIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGE 3205

Query: 60   RIDAIR 43
            R+ A++
Sbjct: 3206 RVAAVQ 3211



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            D EL W++E +    S+D G+ LT   N+ KK   LEA+V+ H  +ID +
Sbjct: 1570 DCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKV 1619



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +++   L +A    Q+ +A E+   WLS+      S + G  L S  +LQKKHA LE ++
Sbjct: 2929 QIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKEL 2988

Query: 75   SSHAERIDAIREPGR 31
             +    ++   + G+
Sbjct: 2989 DTRQSAMNDTEQRGK 3003



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 21/77 (27%), Positives = 38/77 (49%)
 Frame = -3

Query: 279  MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            M +   ++  +   L++    Q +NR  E I+      E  L  ++ G  + SV+NL K+
Sbjct: 1223 MASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKR 1282

Query: 99   HALLEADVSSHAERIDA 49
            H  LEA + +   R++A
Sbjct: 1283 HRDLEAKLDAQEARLEA 1299



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 17/71 (23%), Positives = 35/71 (49%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+ + LQEA    +Y     + E WL E     +S++ G+D    ++  ++  +L+ +V 
Sbjct: 3036 LRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVE 3095

Query: 72   SHAERIDAIRE 40
                 ID +++
Sbjct: 3096 LFKNEIDRLKK 3106



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 14/70 (20%), Positives = 31/70 (44%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+     Q Y +   ++  W+  ++  + SE   +D+ S ++L ++H     ++     
Sbjct: 3362 KLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKP 3421

Query: 60   RIDAIREPGR 31
             +D     GR
Sbjct: 3422 FVDDFARQGR 3431



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = -1

Query: 419  KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +H     E+ A +P    +   G++++  +H+A  +I ++   L    ERL
Sbjct: 2025 EHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERL 2075



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+EA    ++ + VE++  W++E E  + + D GKD+   + L ++     +D     + 
Sbjct: 2300 LEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQT 2359

Query: 57   IDAIREPG 34
            +D I   G
Sbjct: 2360 LDEINRLG 2367



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
            +KH   E+EL   +  +++    GK ++   HFA   I   ++ L      L +S
Sbjct: 2979 KKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKES 3033



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 12/68 (17%), Positives = 31/68 (45%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            ++   ++ +  A+ D+  W+ +    ++ + +  D+   + L KKH  L   +      +
Sbjct: 1133 EQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEV 1192

Query: 54   DAIREPGR 31
            +  +E GR
Sbjct: 1193 EYCQELGR 1200



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = -1

Query: 461  DSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            D  LD  ++   +QKH   EQE+     ++ +I   GK++    H+   +I S V +L
Sbjct: 1481 DQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQL 1538



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            D  +++   Q H+  ++E+  ++PR+ ++    +RL +        QI  R + L   WE
Sbjct: 1908 DVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWE 1967

Query: 272  RLVQSSS*RETSCRKRLNNSSTTGPSRTL 186
             L  ++  R+   R   +  +  G  R L
Sbjct: 1968 ELKNATDDRKDMLRAAFDLHTFNGKVRDL 1996



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = -1

Query: 416 HQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           ++N E E+Q +  R   + A G+RL++    ++  I  R+ ++   WERL
Sbjct: 674 YKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERL 722


>Z75956-5|CAB00130.2| 4063|Caenorhabditis elegans Hypothetical protein
            R31.1 protein.
          Length = 4063

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D+S+LD TNL  K+QKH  F+ EL  N+ R+  +   G++L+   HF   Q+ +++
Sbjct: 2749 QLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL 2808

Query: 296  EELGGIWERLVQSSS 252
             EL   W+ L   S+
Sbjct: 2809 VELRSGWDELRTKSA 2823



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 27/74 (36%), Positives = 46/74 (62%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            LK  +L+EA +     R VEDIE WL +VEG+L S+D+G+D+ S + L KK   L+ +++
Sbjct: 2824 LKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIA 2883

Query: 72   SHAERIDAIREPGR 31
              ++ +  + +  R
Sbjct: 2884 GRSDAVVEMMKKAR 2897



 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 27/73 (36%), Positives = 46/73 (63%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L++AA Q+  +R +ED    L E++  L S+D G DL SV++L +KHA+LE ++  
Sbjct: 1446 KGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGL 1505

Query: 69   HAERIDAIREPGR 31
            +  ++  I   G+
Sbjct: 1506 YGNKLSDIENRGK 1518



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DDS L P+ +  ++ KH+ FE E+ AN+PR+ +I + G  L+  +H+  P +   V ++ 
Sbjct: 1374 DDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVN 1433

Query: 284  GIW 276
              W
Sbjct: 1434 AQW 1436



 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  A +   +NR VED +  + E    + S+DYGKD  SV+ L +K + LE D+S+  +
Sbjct: 2405 ELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQ 2464

Query: 60   RIDAIREPGRASS*KREPL 4
            ++ A  +  +    KR PL
Sbjct: 2465 KLIAHDKDAQKILEKRPPL 2483



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 246 GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           GN L EA   QQY +   + E W+ E    + S+D G+D  + ++L ++HA LE ++ ++
Sbjct: 730 GNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY 789

Query: 66  AERIDAIRE 40
              I  + E
Sbjct: 790 KSDISRLEE 798



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            ++QQY     ++E W++E    L SEDYG D  + + L  KH  L  D++++ + ++ +
Sbjct: 1667 KEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++Q HQ  E E+ ANKP VD+I   G +L  L     P+I++R +EL   W +L
Sbjct: 2238 RLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQL 2289



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 17/63 (26%), Positives = 31/63 (49%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D  +    V++H  +  E+Q  KP VD+    G+R+++  H    +I  +V+ L   W  
Sbjct: 3398 DVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAM 3457

Query: 269  LVQ 261
            L +
Sbjct: 3458 LCE 3460



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/66 (25%), Positives = 38/66 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            ++ +A++  ++ R  +D+  WL E E    +EDYG+DL   Q + ++      ++++  E
Sbjct: 3146 QIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGE 3205

Query: 60   RIDAIR 43
            R+ A++
Sbjct: 3206 RVAAVQ 3211



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            D EL W++E +    S+D G+ LT   N+ KK   LEA+V+ H  +ID +
Sbjct: 1570 DCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKV 1619



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +++   L +A    Q+ +A E+   WLS+      S + G  L S  +LQKKHA LE ++
Sbjct: 2929 QIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKEL 2988

Query: 75   SSHAERIDAIREPGR 31
             +    ++   + G+
Sbjct: 2989 DTRQSAMNDTEQRGK 3003



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 21/77 (27%), Positives = 38/77 (49%)
 Frame = -3

Query: 279  MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            M +   ++  +   L++    Q +NR  E I+      E  L  ++ G  + SV+NL K+
Sbjct: 1223 MASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKR 1282

Query: 99   HALLEADVSSHAERIDA 49
            H  LEA + +   R++A
Sbjct: 1283 HRDLEAKLDAQEARLEA 1299



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 17/71 (23%), Positives = 35/71 (49%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+ + LQEA    +Y     + E WL E     +S++ G+D    ++  ++  +L+ +V 
Sbjct: 3036 LRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVE 3095

Query: 72   SHAERIDAIRE 40
                 ID +++
Sbjct: 3096 LFKNEIDRLKK 3106



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 14/70 (20%), Positives = 31/70 (44%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+     Q Y +   ++  W+  ++  + SE   +D+ S ++L ++H     ++     
Sbjct: 3362 KLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKP 3421

Query: 60   RIDAIREPGR 31
             +D     GR
Sbjct: 3422 FVDDFARQGR 3431



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = -1

Query: 419  KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +H     E+ A +P    +   G++++  +H+A  +I ++   L    ERL
Sbjct: 2025 EHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERL 2075



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+EA    ++ + VE++  W++E E  + + D GKD+   + L ++     +D     + 
Sbjct: 2300 LEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQT 2359

Query: 57   IDAIREPG 34
            +D I   G
Sbjct: 2360 LDEINRLG 2367



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
            +KH   E+EL   +  +++    GK ++   HFA   I   ++ L      L +S
Sbjct: 2979 KKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKES 3033



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 12/68 (17%), Positives = 31/68 (45%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            ++   ++ +  A+ D+  W+ +    ++ + +  D+   + L KKH  L   +      +
Sbjct: 1133 EQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEV 1192

Query: 54   DAIREPGR 31
            +  +E GR
Sbjct: 1193 EYCQELGR 1200



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = -1

Query: 461  DSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            D  LD  ++   +QKH   EQE+     ++ +I   GK++    H+   +I S V +L
Sbjct: 1481 DQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQL 1538



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            D  +++   Q H+  ++E+  ++PR+ ++    +RL +        QI  R + L   WE
Sbjct: 1908 DVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWE 1967

Query: 272  RLVQSSS*RETSCRKRLNNSSTTGPSRTL 186
             L  ++  R+   R   +  +  G  R L
Sbjct: 1968 ELKNATDDRKDMLRAAFDLHTFNGKVRDL 1996



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = -1

Query: 416 HQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           ++N E E+Q +  R   + A G+RL++    ++  I  R+ ++   WERL
Sbjct: 674 YKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERL 722


>AF053496-1|AAC08577.1| 4063|Caenorhabditis elegans beta chain
            spectrin homolog Sma1 protein.
          Length = 4063

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D+S+LD TNL  K+QKH  F+ EL  N+ R+  +   G++L+   HF   Q+ +++
Sbjct: 2749 QLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL 2808

Query: 296  EELGGIWERLVQSSS 252
             EL   W+ L   S+
Sbjct: 2809 VELRSGWDELRTKSA 2823



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 27/74 (36%), Positives = 46/74 (62%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            LK  +L+EA +     R VEDIE WL +VEG+L S+D+G+D+ S + L KK   L+ +++
Sbjct: 2824 LKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIA 2883

Query: 72   SHAERIDAIREPGR 31
              ++ +  + +  R
Sbjct: 2884 GRSDAVVEMMKKAR 2897



 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 27/73 (36%), Positives = 46/73 (63%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L++AA Q+  +R +ED    L E++  L S+D G DL SV++L +KHA+LE ++  
Sbjct: 1446 KGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGL 1505

Query: 69   HAERIDAIREPGR 31
            +  ++  I   G+
Sbjct: 1506 YGNKLSDIENRGK 1518



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DDS L P+ +  ++ KH+ FE E+ AN+PR+ +I + G  L+  +H+  P +   V ++ 
Sbjct: 1374 DDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVN 1433

Query: 284  GIW 276
              W
Sbjct: 1434 AQW 1436



 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  A +   +NR VED +  + E    + S+DYGKD  SV+ L +K + LE D+S+  +
Sbjct: 2405 ELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQ 2464

Query: 60   RIDAIREPGRASS*KREPL 4
            ++ A  +  +    KR PL
Sbjct: 2465 KLIAHDKDAQKILEKRPPL 2483



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 246 GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           GN L EA   QQY +   + E W+ E    + S+D G+D  + ++L ++HA LE ++ ++
Sbjct: 730 GNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY 789

Query: 66  AERIDAIRE 40
              I  + E
Sbjct: 790 KSDISRLEE 798



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            ++QQY     ++E W++E    L SEDYG D  + + L  KH  L  D++++ + ++ +
Sbjct: 1667 KEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++Q HQ  E E+ ANKP VD+I   G +L  L     P+I++R +EL   W +L
Sbjct: 2238 RLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQL 2289



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 17/63 (26%), Positives = 31/63 (49%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D  +    V++H  +  E+Q  KP VD+    G+R+++  H    +I  +V+ L   W  
Sbjct: 3398 DVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAM 3457

Query: 269  LVQ 261
            L +
Sbjct: 3458 LCE 3460



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/66 (25%), Positives = 38/66 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            ++ +A++  ++ R  +D+  WL E E    +EDYG+DL   Q + ++      ++++  E
Sbjct: 3146 QIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGE 3205

Query: 60   RIDAIR 43
            R+ A++
Sbjct: 3206 RVAAVQ 3211



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            D EL W++E +    S+D G+ LT   N+ KK   LEA+V+ H  +ID +
Sbjct: 1570 DCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKV 1619



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +++   L +A    Q+ +A E+   WLS+      S + G  L S  +LQKKHA LE ++
Sbjct: 2929 QIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKEL 2988

Query: 75   SSHAERIDAIREPGR 31
             +    ++   + G+
Sbjct: 2989 DTRQSAMNDTEQRGK 3003



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 21/77 (27%), Positives = 38/77 (49%)
 Frame = -3

Query: 279  MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            M +   ++  +   L++    Q +NR  E I+      E  L  ++ G  + SV+NL K+
Sbjct: 1223 MASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKR 1282

Query: 99   HALLEADVSSHAERIDA 49
            H  LEA + +   R++A
Sbjct: 1283 HRDLEAKLDAQEARLEA 1299



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 17/71 (23%), Positives = 35/71 (49%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+ + LQEA    +Y     + E WL E     +S++ G+D    ++  ++  +L+ +V 
Sbjct: 3036 LRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVE 3095

Query: 72   SHAERIDAIRE 40
                 ID +++
Sbjct: 3096 LFKNEIDRLKK 3106



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 14/70 (20%), Positives = 31/70 (44%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+     Q Y +   ++  W+  ++  + SE   +D+ S ++L ++H     ++     
Sbjct: 3362 KLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKP 3421

Query: 60   RIDAIREPGR 31
             +D     GR
Sbjct: 3422 FVDDFARQGR 3431



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = -1

Query: 419  KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +H     E+ A +P    +   G++++  +H+A  +I ++   L    ERL
Sbjct: 2025 EHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERL 2075



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+EA    ++ + VE++  W++E E  + + D GKD+   + L ++     +D     + 
Sbjct: 2300 LEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQT 2359

Query: 57   IDAIREPG 34
            +D I   G
Sbjct: 2360 LDEINRLG 2367



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
            +KH   E+EL   +  +++    GK ++   HFA   I   ++ L      L +S
Sbjct: 2979 KKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKES 3033



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 12/68 (17%), Positives = 31/68 (45%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            ++   ++ +  A+ D+  W+ +    ++ + +  D+   + L KKH  L   +      +
Sbjct: 1133 EQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEV 1192

Query: 54   DAIREPGR 31
            +  +E GR
Sbjct: 1193 EYCQELGR 1200



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = -1

Query: 461  DSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            D  LD  ++   +QKH   EQE+     ++ +I   GK++    H+   +I S V +L
Sbjct: 1481 DQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQL 1538



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            D  +++   Q H+  ++E+  ++PR+ ++    +RL +        QI  R + L   WE
Sbjct: 1908 DVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWE 1967

Query: 272  RLVQSSS*RETSCRKRLNNSSTTGPSRTL 186
             L  ++  R+   R   +  +  G  R L
Sbjct: 1968 ELKNATDDRKDMLRAAFDLHTFNGKVRDL 1996



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = -1

Query: 416 HQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           ++N E E+Q +  R   + A G+RL++    ++  I  R+ ++   WERL
Sbjct: 674 YKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERL 722


>U64854-2|AAK77611.1| 2257|Caenorhabditis elegans Uncoordinated
           protein 70, isoform a protein.
          Length = 2257

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L    +  Q+    +D++ +L +    + SED GKD  +VQ L KKH  +  ++ +  +
Sbjct: 729 RLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQ 788

Query: 60  RIDAI 46
            I  +
Sbjct: 789 HIKVL 793



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +L+E  +    +R ++D+  W+++ E    S++ G+D   VQ LQ++      D  +  +
Sbjct: 1683 RLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGS 1742

Query: 63   ERI 55
            ER+
Sbjct: 1743 ERV 1745



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE---ADVSS 70
           +L++  +  Q+   V ++E  + E E  L S D G+D+ +V +L  KH   E    D+  
Sbjct: 623 RLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEK 682

Query: 69  HAERID 52
           + +R+D
Sbjct: 683 YLDRLD 688



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -1

Query: 428  KVQKHQ--NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++ KH+    EQ+++  + +V  +  + ++LL +EH     I  R  +L   W +L
Sbjct: 875  EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQL 930



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/46 (23%), Positives = 26/46 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  HQ+ + E+ A +   +   ++G+ LL  +H+A  +I  ++ +L
Sbjct: 1940 MNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKL 1985



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEAD 79
            +L+  +L +A    +     + +E W+ E +G+LL+    G+D+  V+ ++ +   LE D
Sbjct: 829  QLRKQRLIDALSLYKLYSDADSVESWIDE-KGKLLATLVPGRDIEEVEIMKHRFDTLEQD 887

Query: 78   VSSHAERIDAIREPGR 31
            + +   ++  + +  R
Sbjct: 888  MKNQEAKVTNVNDLAR 903



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/61 (21%), Positives = 28/61 (45%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A DD          ++++HQ+F   + AN  ++  +   G +L +  H+A  +I  +   
Sbjct: 1183 AKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARN 1242

Query: 290  L 288
            +
Sbjct: 1243 I 1243


>U64854-1|AAK77612.2| 2302|Caenorhabditis elegans Uncoordinated
           protein 70, isoform b protein.
          Length = 2302

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L    +  Q+    +D++ +L +    + SED GKD  +VQ L KKH  +  ++ +  +
Sbjct: 729 RLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQ 788

Query: 60  RIDAI 46
            I  +
Sbjct: 789 HIKVL 793



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +L+E  +    +R ++D+  W+++ E    S++ G+D   VQ LQ++      D  +  +
Sbjct: 1683 RLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGS 1742

Query: 63   ERI 55
            ER+
Sbjct: 1743 ERV 1745



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE---ADVSS 70
           +L++  +  Q+   V ++E  + E E  L S D G+D+ +V +L  KH   E    D+  
Sbjct: 623 RLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEK 682

Query: 69  HAERID 52
           + +R+D
Sbjct: 683 YLDRLD 688



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -1

Query: 428  KVQKHQ--NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++ KH+    EQ+++  + +V  +  + ++LL +EH     I  R  +L   W +L
Sbjct: 875  EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQL 930



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/46 (23%), Positives = 26/46 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  HQ+ + E+ A +   +   ++G+ LL  +H+A  +I  ++ +L
Sbjct: 1940 MNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKL 1985



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEAD 79
            +L+  +L +A    +     + +E W+ E +G+LL+    G+D+  V+ ++ +   LE D
Sbjct: 829  QLRKQRLIDALSLYKLYSDADSVESWIDE-KGKLLATLVPGRDIEEVEIMKHRFDTLEQD 887

Query: 78   VSSHAERIDAIREPGR 31
            + +   ++  + +  R
Sbjct: 888  MKNQEAKVTNVNDLAR 903



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/61 (21%), Positives = 28/61 (45%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A DD          ++++HQ+F   + AN  ++  +   G +L +  H+A  +I  +   
Sbjct: 1183 AKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARN 1242

Query: 290  L 288
            +
Sbjct: 1243 I 1243


>AF261891-1|AAF72996.1| 2257|Caenorhabditis elegans beta-spectrin
           protein.
          Length = 2257

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L    +  Q+    +D++ +L +    + SED GKD  +VQ L KKH  +  ++ +  +
Sbjct: 729 RLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQ 788

Query: 60  RIDAI 46
            I  +
Sbjct: 789 HIKVL 793



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +L+E  +    +R ++D+  W+++ E    S++ G+D   VQ LQ++      D  +  +
Sbjct: 1683 RLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGS 1742

Query: 63   ERI 55
            ER+
Sbjct: 1743 ERV 1745



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE---ADVSS 70
           +L++  +  Q+   V ++E  + E E  L S D G+D+ +V +L  KH   E    D+  
Sbjct: 623 RLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEK 682

Query: 69  HAERID 52
           + +R+D
Sbjct: 683 YLDRLD 688



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -1

Query: 428  KVQKHQ--NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++ KH+    EQ+++  + +V  +  + ++LL +EH     I  R  +L   W +L
Sbjct: 875  EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQL 930



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/46 (23%), Positives = 26/46 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  HQ+ + E+ A +   +   ++G+ LL  +H+A  +I  ++ +L
Sbjct: 1940 MNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKL 1985



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEAD 79
            +L+  +L +A    +     + +E W+ E +G+LL+    G+D+  V+ ++ +   LE D
Sbjct: 829  QLRKQRLIDALSLYKLYSDADSVESWIDE-KGKLLATLVPGRDIEEVEIMKHRFDTLEQD 887

Query: 78   VSSHAERIDAIREPGR 31
            + +   ++  + +  R
Sbjct: 888  MKNQEAKVTNVNDLAR 903



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/61 (21%), Positives = 28/61 (45%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A DD          ++++HQ+F   + AN  ++  +   G +L +  H+A  +I  +   
Sbjct: 1183 AKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARN 1242

Query: 290  L 288
            +
Sbjct: 1243 I 1243


>AF166170-1|AAD49859.1| 2257|Caenorhabditis elegans beta-G spectrin
           protein.
          Length = 2257

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L    +  Q+    +D++ +L +    + SED GKD  +VQ L KKH  +  ++ +  +
Sbjct: 729 RLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQ 788

Query: 60  RIDAI 46
            I  +
Sbjct: 789 HIKVL 793



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +L+E  +    +R ++D+  W+++ E    S++ G+D   VQ LQ++      D  +  +
Sbjct: 1683 RLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGS 1742

Query: 63   ERI 55
            ER+
Sbjct: 1743 ERV 1745



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE---ADVSS 70
           +L++  +  Q+   V ++E  + E E  L S D G+D+ +V +L  KH   E    D+  
Sbjct: 623 RLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEK 682

Query: 69  HAERID 52
           + +R+D
Sbjct: 683 YLDRLD 688



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -1

Query: 428  KVQKHQ--NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++ KH+    EQ+++  + +V  +  + ++LL +EH     I  R  +L   W +L
Sbjct: 875  EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQL 930



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/46 (23%), Positives = 26/46 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  HQ+ + E+ A +   +   ++G+ LL  +H+A  +I  ++ +L
Sbjct: 1940 MNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKL 1985



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEAD 79
            +L+  +L +A    +     + +E W+ E +G+LL+    G+D+  V+ ++ +   LE D
Sbjct: 829  QLRKQRLIDALSLYKLYSDADSVESWIDE-KGKLLATLVPGRDIEEVEIMKHRFDTLEQD 887

Query: 78   VSSHAERIDAIREPGR 31
            + +   ++  + +  R
Sbjct: 888  MKNQEAKVTNVNDLAR 903



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/61 (21%), Positives = 28/61 (45%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A DD          ++++HQ+F   + AN  ++  +   G +L +  H+A  +I  +   
Sbjct: 1183 AKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARN 1242

Query: 290  L 288
            +
Sbjct: 1243 I 1243


>AF166169-1|AAD49858.1| 2302|Caenorhabditis elegans beta-G spectrin
           protein.
          Length = 2302

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L    +  Q+    +D++ +L +    + SED GKD  +VQ L KKH  +  ++ +  +
Sbjct: 729 RLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQ 788

Query: 60  RIDAI 46
            I  +
Sbjct: 789 HIKVL 793



 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +L+E  +    +R ++D+  W+++ E    S++ G+D   VQ LQ++      D  +  +
Sbjct: 1683 RLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGS 1742

Query: 63   ERI 55
            ER+
Sbjct: 1743 ERV 1745



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE---ADVSS 70
           +L++  +  Q+   V ++E  + E E  L S D G+D+ +V +L  KH   E    D+  
Sbjct: 623 RLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEK 682

Query: 69  HAERID 52
           + +R+D
Sbjct: 683 YLDRLD 688



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -1

Query: 428  KVQKHQ--NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++ KH+    EQ+++  + +V  +  + ++LL +EH     I  R  +L   W +L
Sbjct: 875  EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQL 930



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/46 (23%), Positives = 26/46 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  HQ+ + E+ A +   +   ++G+ LL  +H+A  +I  ++ +L
Sbjct: 1940 MNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKL 1985



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEAD 79
            +L+  +L +A    +     + +E W+ E +G+LL+    G+D+  V+ ++ +   LE D
Sbjct: 829  QLRKQRLIDALSLYKLYSDADSVESWIDE-KGKLLATLVPGRDIEEVEIMKHRFDTLEQD 887

Query: 78   VSSHAERIDAIREPGR 31
            + +   ++  + +  R
Sbjct: 888  MKNQEAKVTNVNDLAR 903



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/61 (21%), Positives = 28/61 (45%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A DD          ++++HQ+F   + AN  ++  +   G +L +  H+A  +I  +   
Sbjct: 1183 AKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARN 1242

Query: 290  L 288
            +
Sbjct: 1243 I 1243


>Z75552-2|CAA99944.1|  894|Caenorhabditis elegans Hypothetical
           protein W04D2.1b protein.
          Length = 894

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           +++ R     E W    E  L S D+    L  ++ L+K+H   E+D+ +H +R++ I  
Sbjct: 402 EKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAA 461

Query: 39  PGRASS*KREP 7
             R  +  R P
Sbjct: 462 IARELNNLRYP 472


>Z75552-1|CAA99941.1|  920|Caenorhabditis elegans Hypothetical
           protein W04D2.1a protein.
          Length = 920

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           +++ R     E W    E  L S D+    L  ++ L+K+H   E+D+ +H +R++ I  
Sbjct: 428 EKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAA 487

Query: 39  PGRASS*KREP 7
             R  +  R P
Sbjct: 488 IARELNNLRYP 498


>Z68104-1|CAA92112.1|  866|Caenorhabditis elegans Hypothetical
           protein F08B12.1 protein.
          Length = 866

 Score = 31.5 bits (68), Expect = 0.48
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELE-HFAQPQISSRVEEL 288
           K + FE+ L AN  R   +T V +++ ELE  FA+P + SR+E L
Sbjct: 650 KTREFEESLDANSGRPKAVTLVLEQIRELEIQFAKP-LRSRLEAL 693


>U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily assigned
            gene nameprotein 308, isoform b protein.
          Length = 4034

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%)
 Frame = -1

Query: 365  ITAVGKRLLELEHFAQPQISSRVEELGGIW------ERLVQSSS*RETSCRKRLNNSSTT 204
            ++ V KR    EH ++   SSR E + G W      ER+V++   R  S +  L+  + +
Sbjct: 1718 VSGVMKRESRKEHSSKKFTSSREEIIQGFWKGERDEERVVKTLKDRMVSFKHSLSVEAAS 1777

Query: 203  GPSRTLNFGSRK 168
              S  ++ G RK
Sbjct: 1778 STSENVSLGMRK 1789


>U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily assigned
            gene nameprotein 308, isoform c protein.
          Length = 7548

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%)
 Frame = -1

Query: 365  ITAVGKRLLELEHFAQPQISSRVEELGGIW------ERLVQSSS*RETSCRKRLNNSSTT 204
            ++ V KR    EH ++   SSR E + G W      ER+V++   R  S +  L+  + +
Sbjct: 1718 VSGVMKRESRKEHSSKKFTSSREEIIQGFWKGERDEERVVKTLKDRMVSFKHSLSVEAAS 1777

Query: 203  GPSRTLNFGSRK 168
              S  ++ G RK
Sbjct: 1778 STSENVSLGMRK 1789


>L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical protein
            C50C3.2 protein.
          Length = 2107

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            Q+   A++D   W  E+     S + G D++S   L++KH  L+ +     +++
Sbjct: 1433 QKVVTAIDDEICWFKEINVIFSSTNVGNDVSSNDVLKRKHQRLQLETQRREQKV 1486


>Z69792-5|CAA93668.3| 1410|Caenorhabditis elegans Hypothetical protein
            F40E10.4 protein.
          Length = 1410

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +2

Query: 338  QADACRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRR 466
            + DAC++    + E     A   SSD +  CH G+S PS  R+
Sbjct: 1072 KTDACQQSACGQGEC---VASQNSSDFTCKCHEGFSGPSCDRQ 1111


>U13643-2|AAN65298.1|  354|Caenorhabditis elegans Hypothetical
           protein T07E3.4b protein.
          Length = 354

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
 Frame = +2

Query: 260 TAPVAPIFRPALPRETIFEVEQNVRAQADA---CRRPLSRRREACWP-AAPVRSSDVSAP 427
           T    P +   +P E +FE+ +N ++   +     R LSRR  AC    A V+ + +S  
Sbjct: 3   TVKEKPTYFDRIPNEILFEILENCKSTEPSTVLAARRLSRRFNACMDHIADVKINVLSRL 62

Query: 428 CHSGWSDPSTSRRWRTF 478
             SG        RW ++
Sbjct: 63  VISGLGKKGIEMRWVSY 79


>U13643-1|AAA21083.1|  427|Caenorhabditis elegans Hypothetical
           protein T07E3.4a protein.
          Length = 427

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
 Frame = +2

Query: 260 TAPVAPIFRPALPRETIFEVEQNVRAQADA---CRRPLSRRREACWP-AAPVRSSDVSAP 427
           T    P +   +P E +FE+ +N ++   +     R LSRR  AC    A V+ + +S  
Sbjct: 76  TVKEKPTYFDRIPNEILFEILENCKSTEPSTVLAARRLSRRFNACMDHIADVKINVLSRL 135

Query: 428 CHSGWSDPSTSRRWRTF 478
             SG        RW ++
Sbjct: 136 VISGLGKKGIEMRWVSY 152


>AL022270-3|CAB63434.2| 1410|Caenorhabditis elegans Hypothetical
            protein F40E10.4 protein.
          Length = 1410

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +2

Query: 338  QADACRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRR 466
            + DAC++    + E     A   SSD +  CH G+S PS  R+
Sbjct: 1072 KTDACQQSACGQGEC---VASQNSSDFTCKCHEGFSGPSCDRQ 1111


>Z71186-8|CAA94917.2| 1322|Caenorhabditis elegans Hypothetical
           protein F23D12.2 protein.
          Length = 1322

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 25/105 (23%), Positives = 39/105 (37%), Gaps = 13/105 (12%)
 Frame = -1

Query: 446 PTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLE-------LEHFAQPQISSRVEEL 288
           P   +    K +  +  L+ +  R DEI A  KR+ E       L      Q+ S    L
Sbjct: 395 PVTFSKDSVKREVLKAPLEISPARGDEIAAAEKRMKEYLEKKNLLSRMLPTQVQSTTASL 454

Query: 287 G------GIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSR 171
                    +E   Q     +  C K  N S ++ P RT +F ++
Sbjct: 455 NKKTGTFAAYENQAQEYKSEQAECSKLTNTSHSSSPLRTFSFENK 499


>U55369-5|AAM29663.2| 1046|Caenorhabditis elegans Hypothetical
           protein C18C4.5b protein.
          Length = 1046

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = -1

Query: 437 LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           L  +VQ  Q  EQ+L+  K RV E+T   +++LE +     +  + +  L  + E
Sbjct: 422 LKSQVQLQQQLEQDLELQKKRVQELTE-QRKVLESKASVADEFGTLMSSLNSLRE 475


>U55369-4|AAM29662.1| 1022|Caenorhabditis elegans Hypothetical
           protein C18C4.5a protein.
          Length = 1022

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = -1

Query: 437 LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           L  +VQ  Q  EQ+L+  K RV E+T   +++LE +     +  + +  L  + E
Sbjct: 422 LKSQVQLQQQLEQDLELQKKRVQELTE-QRKVLESKASVADEFGTLMSSLNSLRE 475


>AF100306-1|AAC68921.1|  423|Caenorhabditis elegans Hypothetical
           protein T24C4.2 protein.
          Length = 423

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = -1

Query: 395 LQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGI 279
           +   K  VD +     RLL   H  +  + SRV++L G+
Sbjct: 378 IAVTKAEVDSVLGAASRLLNDNHLPEDVLHSRVKQLNGL 416


>AC087232-1|AAK09079.2|  574|Caenorhabditis elegans Hypothetical
           protein Y92H12BR.7 protein.
          Length = 574

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 233 CNLFPFSSKTAPVAPIFRPA 292
           CNL+P   K  PVAP+   A
Sbjct: 453 CNLYPIGKKKLPVAPVVEAA 472


>U23511-13|AAC46800.1|  770|Caenorhabditis elegans Hypothetical
           protein C32D5.11 protein.
          Length = 770

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = -1

Query: 350 KRLLELEHFAQPQISSRVEELGGIWERLVQS 258
           + +LE  HF QP    R+EE+  ++ R  Q+
Sbjct: 647 RSILERRHFPQPPREQRIEEVEQLFNRAYQN 677


>AC006708-24|AAF60413.1|  660|Caenorhabditis elegans Hypothetical
           protein Y110A7A.19 protein.
          Length = 660

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = -3

Query: 258 FELKGNKLQEAAQQQQ-YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNL 109
           F+L  N+ +E+ +Q++ YN  +     WL+E++  L  +   K +TS  NL
Sbjct: 329 FKLLDNEKRESDEQKKTYNHQLTVAISWLNEIQNSLTGKTL-KPITSTCNL 378


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,025,928
Number of Sequences: 27780
Number of extensions: 253094
Number of successful extensions: 1168
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 908
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1165
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1289949676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).