SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   103   3e-23
Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   103   3e-23
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   103   3e-23
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   103   3e-23
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       103   3e-23
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       103   3e-23
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       103   3e-23
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       103   3e-23
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   103   3e-23
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   103   3e-23
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   103   3e-23
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   103   3e-23
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   103   3e-23
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   103   3e-23
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...    87   6e-18
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...    57   4e-09
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...    46   1e-05
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    40   8e-04
U61948-1|AAB03144.2| 1432|Caenorhabditis elegans Hypothetical pr...    27   3.6  
AF016440-5|AAB65904.2|  535|Caenorhabditis elegans Hypothetical ...    27   3.6  
AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of e...    27   3.6  
Z93379-3|CAB07590.1|  282|Caenorhabditis elegans Hypothetical pr...    27   4.8  
Z81047-2|CAB02828.1|  376|Caenorhabditis elegans Hypothetical pr...    27   4.8  
Z50755-2|CAA90633.1|  444|Caenorhabditis elegans Hypothetical pr...    27   4.8  
AF077544-5|AAK39240.1|  398|Caenorhabditis elegans Aspartyl prot...    27   4.8  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    27   4.8  
AF100663-1|AAC68979.2|  173|Caenorhabditis elegans Hypothetical ...    26   8.4  
AF016440-6|AAN84798.1|  525|Caenorhabditis elegans Hypothetical ...    26   8.4  
AF003142-8|AAB54185.2|  205|Caenorhabditis elegans Hypothetical ...    26   8.4  

>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 73.3 bits (172), Expect = 6e-14
 Identities = 33/37 (89%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 78.6 bits (185), Expect = 1e-15
 Identities = 35/39 (89%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++VAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 77.0 bits (181), Expect = 5e-15
 Identities = 33/39 (84%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++VAAL++DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 23  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 69



 Score = 41.1 bits (92), Expect = 3e-04
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +2

Query: 197 KAGFAGYDAPRAVFPSIVGSP 259
           +AGFAG DAPRAVFPSIVG P
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRP 25


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 78.6 bits (185), Expect = 1e-15
 Identities = 35/39 (89%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++VAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 78.6 bits (185), Expect = 1e-15
 Identities = 35/39 (89%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++VAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  103 bits (248), Expect = 3e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 79.8 bits (188), Expect = 6e-16
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score = 86.6 bits (205), Expect = 6e-18
 Identities = 38/39 (97%), Positives = 38/39 (97%)
 Frame = +1

Query: 274 MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 39


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score = 57.2 bits (132), Expect = 4e-09
 Identities = 21/47 (44%), Positives = 33/47 (70%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P++  VM G    D ++G +A+S RG+ +++YP+EHGI  NW DM
Sbjct: 39  GRPKYHRVMAGGLDGDIFIGPKAESNRGLFSIEYPMEHGIVNNWSDM 85



 Score = 41.1 bits (92), Expect = 3e-04
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  F + VG P
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRP 41


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score = 46.0 bits (104), Expect = 1e-05
 Identities = 18/35 (51%), Positives = 26/35 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +VVDNG+G  K G+AG + P  +FPS+VG P +R+
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRS 43



 Score = 41.5 bits (93), Expect = 2e-04
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VG+E    R +L + YP+++GI  NWDDM
Sbjct: 53  KDLMVGEECSQLRQMLDINYPMDNGIVRNWDDM 85


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 39.5 bits (88), Expect = 8e-04
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGI-LTLKYPIEHGIATNWDDM 390
           V  G+   D ++GDEA S      T+KYPI HGI  +WD M
Sbjct: 56  VGAGIDDLDFFIGDEALSPAATNYTVKYPIRHGIVEDWDLM 96



 Score = 35.5 bits (78), Expect = 0.014
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           M   ++ A V+DNG+G  K G+AG   P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36


>U61948-1|AAB03144.2| 1432|Caenorhabditis elegans Hypothetical
           protein C46A5.4 protein.
          Length = 1432

 Score = 27.5 bits (58), Expect = 3.6
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +1

Query: 127 ISLIQDVRRRSCRVGSRQWLRYVQGRLRRI 216
           + + ++   +  R+G RQW RY +G  RRI
Sbjct: 655 LPITKETVEKVIRLGLRQWQRYEEGEGRRI 684


>AF016440-5|AAB65904.2|  535|Caenorhabditis elegans Hypothetical
           protein F29G9.2a protein.
          Length = 535

 Score = 27.5 bits (58), Expect = 3.6
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = -3

Query: 261 AGLPTIEGNTARGASYPAKPAL-HIPEPLSTTNAATSSS 148
           A + +  G++A    Y AKP L H+P P STT ++  SS
Sbjct: 9   ANMSSESGSSASTVHY-AKPVLRHVPMPSSTTPSSIGSS 46


>AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of
           efl-1 mutant phenotypeprotein 1 protein.
          Length = 4177

 Score = 27.5 bits (58), Expect = 3.6
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -3

Query: 381 PVSGDSVFDGVFEGQDTSFALCLISYIRVLLSHTDHH 271
           PVS DSV    F  +D     CL+S +R+L++  D H
Sbjct: 232 PVSSDSVPSQQFSKEDL---YCLLSRVRMLVTFEDWH 265


>Z93379-3|CAB07590.1|  282|Caenorhabditis elegans Hypothetical
           protein F21H7.4 protein.
          Length = 282

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = -2

Query: 316 PHLLHKSPSVPYRPSRPDGGASHDRG 239
           PH  H+ P  P+RP RP      D G
Sbjct: 80  PHRPHRPPHRPHRPPRPPPRPECDEG 105


>Z81047-2|CAB02828.1|  376|Caenorhabditis elegans Hypothetical
           protein C41G6.3 protein.
          Length = 376

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 176 DNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA*W 277
           DN + +CK+ F  +  PR V  + V  P + + W
Sbjct: 195 DNANEICKSMFESFITPRYVLATPVNLPKLMSTW 228


>Z50755-2|CAA90633.1|  444|Caenorhabditis elegans Hypothetical
           protein R12H7.2 protein.
          Length = 444

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWD 289
           F +  E+    V   G  +C +GF G D P  V    I+G   I   +SV+D
Sbjct: 350 FSLKGEDYVLKVSQGGKTICLSGFMGIDLPERVGELWILGDVFIGRYYSVFD 401


>AF077544-5|AAK39240.1|  398|Caenorhabditis elegans Aspartyl
           protease protein 3 protein.
          Length = 398

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = +2

Query: 179 NGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWD 289
           NG   C +GF G D P    P  I+G   I   +SV+D
Sbjct: 346 NGGSTCLSGFMGMDIPAPAGPLWILGDVFIGRFYSVFD 383


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +2

Query: 197 KAGFAGYDAPRAVFPSIVGSPAIR 268
           KA + G+D P+A F  I+G+   R
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYR 67


>AF100663-1|AAC68979.2|  173|Caenorhabditis elegans Hypothetical
           protein K08B4.2 protein.
          Length = 173

 Score = 26.2 bits (55), Expect = 8.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 50  IGYLFLTVSSHCRAFNFHLVTPTSY*FH*FKMCDEEV 160
           +  LFLTVS +  AF F ++  T   F   +  DEEV
Sbjct: 6   VAILFLTVSQYGSAFEFQVLDYTPVEFSFNQDIDEEV 42


>AF016440-6|AAN84798.1|  525|Caenorhabditis elegans Hypothetical
           protein F29G9.2b protein.
          Length = 525

 Score = 26.2 bits (55), Expect = 8.4
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = -3

Query: 240 GNTARGASYPAKPAL-HIPEPLSTTNAATSSS 148
           G++A    Y AKP L H+P P STT ++  SS
Sbjct: 6   GSSASTVHY-AKPVLRHVPMPSSTTPSSIGSS 36


>AF003142-8|AAB54185.2|  205|Caenorhabditis elegans Hypothetical
           protein F57C9.2 protein.
          Length = 205

 Score = 26.2 bits (55), Expect = 8.4
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = -2

Query: 265 DGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVA 146
           +G     R + C  + I C  G     A+VY   GNFF++
Sbjct: 53  EGSVRLSRDECCKATPIMCLQGQVCLRALVYSPYGNFFLS 92


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,914,720
Number of Sequences: 27780
Number of extensions: 220453
Number of successful extensions: 731
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 731
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 598330768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).