SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41528-3|AAK39170.2|  594|Caenorhabditis elegans Kinesin-like pr...    30   1.6  
AL023858-1|CAA19568.2|  328|Caenorhabditis elegans Hypothetical ...    29   2.1  
U29244-15|AAC71096.2|  471|Caenorhabditis elegans Hypothetical p...    29   3.6  
Z98866-19|CAB11556.2|  259|Caenorhabditis elegans Hypothetical p...    28   4.8  
M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical pr...    28   4.8  
M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z81048-2|CAB02840.1|  553|Caenorhabditis elegans Hypothetical pr...    28   6.3  
U58086-1|AAC47123.1|  803|Caenorhabditis elegans CUL-4 protein.        28   6.3  
U29536-1|AAA68791.3|  840|Caenorhabditis elegans Cullin protein ...    28   6.3  

>U41528-3|AAK39170.2|  594|Caenorhabditis elegans Kinesin-like
           protein protein 8 protein.
          Length = 594

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +1

Query: 229 GKTELVKSSEEYLDRRRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANP 369
           G+  ++K S E L+++R+ S     P+ + W    M  +YEKF+  + NP
Sbjct: 252 GENMVLKESLEQLEKKRSLS-----PVDEFWFRDGMSDEYEKFKKDNGNP 296


>AL023858-1|CAA19568.2|  328|Caenorhabditis elegans Hypothetical
           protein ZK285.1 protein.
          Length = 328

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
 Frame = -2

Query: 483 EPVY*LN-EGCQYLGVVNFLDDQHGEGRLDQVSLCDAGSWICMTMAEFFIILPHGPNLLY 307
           E V  LN E C Y+    +  D+HGE + D +S    G  I +    F  ++  G N   
Sbjct: 165 EQVLKLNIEECAYVAFWFWPVDEHGEFQPDLISFLGFGIMILILSWSFISVVYFGFNCYK 224

Query: 306 WGRRVQGSSSPSVQVL 259
           +  +  GS S   Q L
Sbjct: 225 YISKQMGSLSSQSQAL 240


>U29244-15|AAC71096.2|  471|Caenorhabditis elegans Hypothetical
           protein ZK1248.15 protein.
          Length = 471

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 17/54 (31%), Positives = 24/54 (44%)
 Frame = +1

Query: 247 KSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPP 408
           K+ E   D   TR     SP++     R+D E+  HG  +      E D+V PP
Sbjct: 40  KTKESLWDHPNTRKNEEKSPVKAKTRKRKDVEENIHGTMDDDK--MEVDVVPPP 91


>Z98866-19|CAB11556.2|  259|Caenorhabditis elegans Hypothetical
           protein Y49E10.22 protein.
          Length = 259

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = -1

Query: 580 FHPTVKSPILPQRSVSSKNCRLDEPPPCFCHERASVLVERRV 455
           F  T K PI+P+  VS K   + +PPP    E   VL  R V
Sbjct: 166 FDFTAKKPIVPE--VSLKKSHIQKPPPPSKLESLDVLTRRLV 205


>M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical
           protein ZK370.4b protein.
          Length = 1353

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/42 (35%), Positives = 19/42 (45%)
 Frame = +3

Query: 399 QASPHRAGHQESSRRPDTGTLRSTSTLARS*QKHGGGSSRRQ 524
           Q SP R    ESS   +   +    ++ R   KHG  S RRQ
Sbjct: 143 QDSPGRTPTDESSDEENANVVMGGGSVPRRRSKHGNSSRRRQ 184


>M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical
           protein ZK370.4a protein.
          Length = 1342

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/42 (35%), Positives = 19/42 (45%)
 Frame = +3

Query: 399 QASPHRAGHQESSRRPDTGTLRSTSTLARS*QKHGGGSSRRQ 524
           Q SP R    ESS   +   +    ++ R   KHG  S RRQ
Sbjct: 143 QDSPGRTPTDESSDEENANVVMGGGSVPRRRSKHGNSSRRRQ 184


>Z81048-2|CAB02840.1|  553|Caenorhabditis elegans Hypothetical
           protein C41G7.3 protein.
          Length = 553

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -3

Query: 590 PDVLSPDGKVPNTPAKECVIQKL 522
           P  LSP  ++P TP K CV++K+
Sbjct: 220 PPRLSPVQELPLTPPKTCVVEKI 242


>U58086-1|AAC47123.1|  803|Caenorhabditis elegans CUL-4 protein.
          Length = 803

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 5/105 (4%)
 Frame = +1

Query: 187 LFKKMLRRQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHAN 366
           LF + L      ++  T  V  + EY     T  +N P  ++   T  QD+ + +HG+ N
Sbjct: 541 LFNQYLEHMNKEKANFTARV-ITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRN 599

Query: 367 P--GSGVAEADL---VKPPLTVLVIKKVHDAQILAPFVQLVHWLV 486
                G+A A +    +P     +I  ++   IL  F +   W V
Sbjct: 600 VKWHHGLASAVISASFRPGCKKELIATMYQTVILLLFNKCETWTV 644


>U29536-1|AAA68791.3|  840|Caenorhabditis elegans Cullin protein 4
           protein.
          Length = 840

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 5/105 (4%)
 Frame = +1

Query: 187 LFKKMLRRQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHAN 366
           LF + L      ++  T  V  + EY     T  +N P  ++   T  QD+ + +HG+ N
Sbjct: 578 LFNQYLEHMNKEKANFTARV-ITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRN 636

Query: 367 P--GSGVAEADL---VKPPLTVLVIKKVHDAQILAPFVQLVHWLV 486
                G+A A +    +P     +I  ++   IL  F +   W V
Sbjct: 637 VKWHHGLASAVISASFRPGCKKELIATMYQTVILLLFNKCETWTV 681


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,881,622
Number of Sequences: 27780
Number of extensions: 358361
Number of successful extensions: 1024
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 992
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1022
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1374536540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).