SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z54238-8|CAA90998.3|  459|Caenorhabditis elegans Hypothetical pr...    33   0.11 
AC006672-7|AAM98004.1|  668|Caenorhabditis elegans Hypothetical ...    31   0.43 
Z82086-4|CAB04998.1|  329|Caenorhabditis elegans Hypothetical pr...    27   6.9  

>Z54238-8|CAA90998.3|  459|Caenorhabditis elegans Hypothetical
           protein T28C6.7 protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +1

Query: 139 PVLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKL 318
           P L A  S    +   ER AR        ++ QR  +      T +  PLD P++PS KL
Sbjct: 90  PSLMAHSSVPLSNSKSERRAR--SSSPGHVIAQRKTMVSSSSGTFSPPPLDPPFDPSSKL 147

Query: 319 TPYPSFEG 342
           +  P  +G
Sbjct: 148 SALPDIDG 155


>AC006672-7|AAM98004.1|  668|Caenorhabditis elegans Hypothetical
           protein K08D12.6 protein.
          Length = 668

 Score = 31.5 bits (68), Expect = 0.43
 Identities = 24/82 (29%), Positives = 34/82 (41%)
 Frame = +1

Query: 88  KAPRNILVERGRLELPGPVLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALGIPA 267
           +AP +  VE+  + +P P   AA + D  S     T   YR        ++   A   PA
Sbjct: 371 EAPADAPVEQAPVAVPAPAPTAAPAPDCGSAAPAATDSGYRSKRNAYGDEQVTPA---PA 427

Query: 268 TLNYIPLDAPYEPSPKLTPYPS 333
                P DAP E +P   P P+
Sbjct: 428 AAAEAPADAPVEQAPVAVPAPA 449


>Z82086-4|CAB04998.1|  329|Caenorhabditis elegans Hypothetical
           protein ZK228.7 protein.
          Length = 329

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%)
 Frame = +3

Query: 426 DVWHLWIRQRYKCVPRT---RSMYFDLNTDQIIP 518
           D+  +W++Q   C+P     R  YF + TD  IP
Sbjct: 160 DIGKIWMKQNVPCLPEEVLHRPGYFVIATDNTIP 193


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,383,256
Number of Sequences: 27780
Number of extensions: 289973
Number of successful extensions: 694
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 667
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 691
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1144922904
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).