SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z75952-5|CAB00093.2|  149|Caenorhabditis elegans Hypothetical pr...    42   4e-04
Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical pr...    40   0.002
Z66499-4|CAA91301.1|  164|Caenorhabditis elegans Hypothetical pr...    40   0.002
U58760-7|AAK31463.1|  188|Caenorhabditis elegans Hypothetical pr...    40   0.002
U55854-7|AAK68158.1|  166|Caenorhabditis elegans Hypothetical pr...    40   0.002
U55854-6|AAK68161.1|  197|Caenorhabditis elegans Hypothetical pr...    39   0.003
Z49886-6|CAI79131.1|  149|Caenorhabditis elegans Hypothetical pr...    35   0.042
Z49886-5|CAA90055.1|  152|Caenorhabditis elegans Hypothetical pr...    35   0.042
Z70038-7|CAA93886.2|  373|Caenorhabditis elegans Hypothetical pr...    35   0.056
AC006696-8|AAF39989.1|  120|Caenorhabditis elegans Hypothetical ...    35   0.056
Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical pr...    34   0.074
U53149-1|AAD31546.1|  328|Caenorhabditis elegans Prion-like-(q/n...    33   0.17 
U46675-1|AAB52645.2|  524|Caenorhabditis elegans Hypothetical pr...    33   0.22 
U00046-1|AAC47044.3| 2560|Caenorhabditis elegans Temporarily ass...    31   0.91 
AB206836-1|BAD91087.1| 2502|Caenorhabditis elegans Ten-1S protein.     31   0.91 
AB206835-1|BAD91086.1| 2684|Caenorhabditis elegans Ten-1L protein.     31   0.91 
Z83127-1|CAB05630.1|  160|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical ...    30   1.6  
AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin (droso...    30   1.6  
AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin (droso...    30   1.6  
AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin (droso...    30   1.6  
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    30   1.6  
Z68108-15|CAJ58502.1|  582|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-14|CAA92133.3| 2066|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-13|CAF31493.1| 2048|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-12|CAF31492.1| 2101|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-11|CAF31491.1| 2134|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-10|CAF31490.1| 1888|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z68108-9|CAF31489.1| 1927|Caenorhabditis elegans Hypothetical pr...    29   2.1  
Z68108-8|CAF31488.1| 1509|Caenorhabditis elegans Hypothetical pr...    29   2.1  
Z68108-5|CAD44152.2|  725|Caenorhabditis elegans Hypothetical pr...    29   2.1  
U80023-2|AAG24035.1|  204|Caenorhabditis elegans Hypothetical pr...    29   2.1  
U39644-2|AAA80360.2|  966|Caenorhabditis elegans Hypothetical pr...    29   2.1  
U28736-2|AAA68307.1|  620|Caenorhabditis elegans Hypothetical pr...    29   2.1  
AY390537-1|AAQ94949.1|  692|Caenorhabditis elegans SMA-9 class B...    29   2.1  
AY389809-1|AAR28681.1|  909|Caenorhabditis elegans zinc finger t...    29   2.1  
Z82052-6|CAB04829.4|  327|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z77658-8|CAE17788.1|   79|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z48241-4|CAA88284.1|  468|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z48241-3|CAC42265.1|  490|Caenorhabditis elegans Hypothetical pr...    29   2.8  
AF241847-1|AAF71523.1|  468|Caenorhabditis elegans LAG-3B protein.     29   2.8  
AF241846-1|AAF71522.1|  490|Caenorhabditis elegans LAG-3A protein.     29   2.8  
AC006790-9|AAF60735.1|  382|Caenorhabditis elegans Hypothetical ...    29   2.8  
AC024781-3|AAK39330.2| 2203|Caenorhabditis elegans Prion-like-(q...    29   3.7  
Z92832-6|CAB07375.2|  572|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z81122-3|CAB54313.1| 1076|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z81122-2|CAB03354.1| 1074|Caenorhabditis elegans Hypothetical pr...    28   4.8  
AF100306-10|AAC68926.1|  798|Caenorhabditis elegans Hypothetical...    28   4.8  
Z98877-9|CAB63405.1|  348|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z93395-2|CAB07705.1|  905|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z83112-5|CAB05541.1|  905|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z81595-8|CAB54305.1|  345|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z81595-7|CAB54304.1|  358|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z49068-2|CAA88855.1|  389|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AL132951-7|CAD89753.2|  608|Caenorhabditis elegans Hypothetical ...    28   6.4  
AF078784-2|AAK18966.1|  258|Caenorhabditis elegans Hypothetical ...    28   6.4  
AF016679-7|AAB66161.1|  333|Caenorhabditis elegans Hypothetical ...    28   6.4  
Z96047-4|CAB09414.1|  796|Caenorhabditis elegans Hypothetical pr...    27   8.4  
AF003151-17|ABJ99068.1|   99|Caenorhabditis elegans Hypothetical...    27   8.4  

>Z75952-5|CAB00093.2|  149|Caenorhabditis elegans Hypothetical
           protein F29D10.2 protein.
          Length = 149

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 1/57 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG-SLHSPCSCCIC 433
           CC   C  RC  CC  +C  +CC +    CC    C CC     G      C CC C
Sbjct: 66  CCC--CRPRCCCCCRPKCCCTCCRT----CCCTRCCTCCRPCCCGCGCGCGCGCCGC 116



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 16/44 (36%), Positives = 16/44 (36%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC 379
           P C   C    C   C  CC  RC T C P     CC    C C
Sbjct: 71  PRCCCCCRPKCCCTCCRTCCCTRCCTCCRP-----CCCGCGCGC 109



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCICCR 439
           C  CC    G   C   G  CC    C CC      +    C    CC CCR
Sbjct: 51  CCGCCGCGGGGGGC---GCCCCRPRCCCCCRPKCCCTCCRTCCCTRCCTCCR 99


>Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical
           protein R13H4.8 protein.
          Length = 212

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG-SLHSPCSCCI 430
           C   CC   C  RC  CC  RC T CC +    CC    C CC     G      C CC 
Sbjct: 82  CGCGCCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCCRPCCCGCGCGCGCGCCG 133

Query: 431 C 433
           C
Sbjct: 134 C 134



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC---FAILCWCCSNPASG 400
           C   CC   C  RC  CC   C T CC      CC       C CC     G
Sbjct: 89  CRPRCCC--CCRRCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCGCCGCGGGG 138



 Score = 34.3 bits (75), Expect = 0.074
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   CG  CC      CC    C CC    +      C+ CC CCR
Sbjct: 79  CCG--CGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 117


>Z66499-4|CAA91301.1|  164|Caenorhabditis elegans Hypothetical
           protein T01B7.8 protein.
          Length = 164

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/56 (39%), Positives = 23/56 (41%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC   C  RC  CC  RC T CC +    CC    C CC  P        C CC C
Sbjct: 84  CCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCC-RPCCCGCGCGCGCCGC 130



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-FAILCWCCSNPASG 400
           C   CC   C  RC  CC   C T CC      CC     C CC     G
Sbjct: 87  CRPRCCC--CCRRCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCCGCGGGG 134



 Score = 35.1 bits (77), Expect = 0.042
 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   C   C  C     G  CC      CC    C CC    +      C+ CC CCR
Sbjct: 65  CCGCGCG--CCGCGGGGGGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 115


>U58760-7|AAK31463.1|  188|Caenorhabditis elegans Hypothetical
           protein C27A2.5 protein.
          Length = 188

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/60 (36%), Positives = 23/60 (38%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C   CC   C   C  CC  RC T CC +    CC    C CC  P        C CC C
Sbjct: 83  CGCCCCRPKC---C--CCCRRCCT-CCRT----CCCTRCCTCC-RPCCCGCGCGCGCCGC 131



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-FAILCWCCSNPASG 400
           C   CC   C  RC  CC   C T CC      CC     C CC     G
Sbjct: 88  CRPKCCC--CCRRCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCCGCGGGG 135



 Score = 34.7 bits (76), Expect = 0.056
 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   C      CC   CG       G  CC    C CC    +      C+ CC CCR
Sbjct: 65  CCGCGCG-----CCG--CGGGGGGGCGCCCCRPKCCCCCRRCCTCCRTCCCTRCCTCCR 116


>U55854-7|AAK68158.1|  166|Caenorhabditis elegans Hypothetical
           protein C04G6.10 protein.
          Length = 166

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/56 (39%), Positives = 23/56 (41%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC   C  RC  CC  RC T CC +    CC    C CC  P        C CC C
Sbjct: 85  CCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCC-RPCCCGCGCGCGCCGC 131



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-FAILCWCCSNPASG 400
           C   CC   C  RC  CC   C T CC      CC     C CC     G
Sbjct: 88  CRPRCCC--CCRRCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCCGCGGGG 135



 Score = 35.1 bits (77), Expect = 0.042
 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   C   C  C     G  CC      CC    C CC    +      C+ CC CCR
Sbjct: 66  CCGCGCG--CCGCGGGGGGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 116


>U55854-6|AAK68161.1|  197|Caenorhabditis elegans Hypothetical
           protein C04G6.7 protein.
          Length = 197

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/45 (37%), Positives = 17/45 (37%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           CC   C   C  CC  RC T C P     CC    C CC     G
Sbjct: 95  CCCRRCCTCCRTCCCTRCCTCCRP-----CCCGCGCGCCGCGGGG 134



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 22/56 (39%), Positives = 23/56 (41%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC   C  RC  CC  RC T CC +    CC    C CC     G     C CC C
Sbjct: 86  CCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCCRPCCCG---CGCGCCGC 130



 Score = 35.1 bits (77), Expect = 0.042
 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   C   C  C     G  CC      CC    C CC    +      C+ CC CCR
Sbjct: 67  CCGCGCG--CCGCGGGGGGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 117



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C + CC+  CT  C  CC   CG  CC   G
Sbjct: 104 CRTCCCTRCCTC-CRPCCCG-CGCGCCGCGG 132


>Z49886-6|CAI79131.1|  149|Caenorhabditis elegans Hypothetical
           protein C06A1.7 protein.
          Length = 149

 Score = 35.1 bits (77), Expect = 0.042
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C + CC+  CT     CC   CG  CC   G
Sbjct: 88  CRTCCCTRCCTCCRPCCCGCGCGCGCCGCGG 118



 Score = 34.3 bits (75), Expect = 0.074
 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-FAILCWCCSNPASG 400
           C   CC       C  CC   C T CC      CC     C CC     G
Sbjct: 71  CRPRCCCCCRPKCCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCCGCGGGG 120



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCSCCI 430
           C   CC   C   C   C   C  +CC +    CC    C C C           C CC 
Sbjct: 66  CGCCCCRPRCCCCCRPKCCCTCCRTCCCTRCCTCCRPCCCGCGCG----------CGCCG 115

Query: 431 C 433
           C
Sbjct: 116 C 116



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 16/44 (36%), Positives = 16/44 (36%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC 379
           P C   C    C   C  CC  RC T C P     CC    C C
Sbjct: 73  PRCCCCCRPKCCCTCCRTCCCTRCCTCCRP-----CCCGCGCGC 111



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCICCR 439
           C  CC    G   C   G  CC    C CC      +    C    CC CCR
Sbjct: 53  CCGCCGCGGGGGGC---GCCCCRPRCCCCCRPKCCCTCCRTCCCTRCCTCCR 101



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/48 (31%), Positives = 17/48 (35%), Gaps = 3/48 (6%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC---CICC 436
           CC  RC   C P     CC      CC+   +      C C   C CC
Sbjct: 70  CCRPRCCCCCRPKC---CCTCCRTCCCTRCCTCCRPCCCGCGCGCGCC 114


>Z49886-5|CAA90055.1|  152|Caenorhabditis elegans Hypothetical
           protein C06A1.6 protein.
          Length = 152

 Score = 35.1 bits (77), Expect = 0.042
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C + CC+  CT     CC   CG  CC   G
Sbjct: 91  CRTCCCTRCCTCCRPCCCGCGCGCGCCGCGG 121



 Score = 34.3 bits (75), Expect = 0.074
 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-FAILCWCCSNPASG 400
           C   CC       C  CC   C T CC      CC     C CC     G
Sbjct: 74  CRPRCCCCCRPKCCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCCGCGGGG 123



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCSCCI 430
           C   CC   C   C   C   C  +CC +    CC    C C C           C CC 
Sbjct: 69  CGCCCCRPRCCCCCRPKCCCTCCRTCCCTRCCTCCRPCCCGCGCG----------CGCCG 118

Query: 431 C 433
           C
Sbjct: 119 C 119



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 16/44 (36%), Positives = 16/44 (36%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC 379
           P C   C    C   C  CC  RC T C P     CC    C C
Sbjct: 76  PRCCCCCRPKCCCTCCRTCCCTRCCTCCRP-----CCCGCGCGC 114



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCICCR 439
           C  CC    G   C   G  CC    C CC      +    C    CC CCR
Sbjct: 56  CCGCCGCGGGGGGC---GCCCCRPRCCCCCRPKCCCTCCRTCCCTRCCTCCR 104



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/48 (31%), Positives = 17/48 (35%), Gaps = 3/48 (6%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC---CICC 436
           CC  RC   C P     CC      CC+   +      C C   C CC
Sbjct: 73  CCRPRCCCCCRPKC---CCTCCRTCCCTRCCTCCRPCCCGCGCGCGCC 117


>Z70038-7|CAA93886.2|  373|Caenorhabditis elegans Hypothetical
           protein ZK1067.7 protein.
          Length = 373

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 3/65 (4%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           P+C   C   C  +C   C   C   C +SC  +   +   A     CSN  S    S C
Sbjct: 207 PICIQSCQSSCQQACQPTCQPQCMPSCSSSCTSNQAPIVIVAQQGDSCSNSCSNQCQSAC 266

Query: 419 SCCIC 433
              IC
Sbjct: 267 PTPIC 271



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 23/84 (27%), Positives = 31/84 (36%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL--HSPCSCC 427
           CN+ C S   T  C   C + C  +C P+    C  +    C SN A   +      SC 
Sbjct: 196 CNNQCSSSCSTPICIQSCQSSCQQACQPTCQPQCMPSCSSSCTSNQAPIVIVAQQGDSCS 255

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C     S+  +   V  C S C
Sbjct: 256 NSCSNQCQSACPTPICVQQCNSQC 279



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/79 (24%), Positives = 29/79 (36%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLP 445
           CC  +  ++C   C  +C +SC  S  I  C       C       L    + C  C+  
Sbjct: 52  CCGNNNNVQCIPVCLQQCQSSCQTSQCIQQCQPACNQQCGGNNQVILLPQTNNCNQCQQQ 111

Query: 446 IWSSTSSTFPVWICTSVCS 502
             SS ++      C + CS
Sbjct: 112 CISSCATPICAQSCNNQCS 130



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 17/64 (26%), Positives = 25/64 (39%), Gaps = 3/64 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSC---CPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           C   C S   T  C   C+N+C +SC    P   +L      C  C +    +  + C+C
Sbjct: 108 CQQQCISSCATPICAQSCNNQCSSSCGNSAPQIVVLQPQQNQCGSCQSSCQQTCPT-CNC 166

Query: 425 CICC 436
              C
Sbjct: 167 QSAC 170



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSS 343
           C S C +  C  +C   C ++C  SC  +S
Sbjct: 262 CQSACPTPICVQQCNSQCQSQCSNSCSGNS 291


>AC006696-8|AAF39989.1|  120|Caenorhabditis elegans Hypothetical
           protein W08E12.2 protein.
          Length = 120

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC 358
           CN  C    C  RC++C +N   +SCC S+   CC
Sbjct: 67  CNP-CNGGGCAPRCSYCPNNFGYSSCCNSNNFSCC 100


>Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical
           protein M02G9.3 protein.
          Length = 294

 Score = 34.3 bits (75), Expect = 0.074
 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 2/62 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGSLHSPCSCC 427
           CNS C     T  CT  CSN C  +C       I+         C N       S C+  
Sbjct: 132 CNSQCLQICTTPSCTNTCSNSCSNACSNGGNQPIVIVIPSSSRNCQNSCQNQCSSACTTM 191

Query: 428 IC 433
            C
Sbjct: 192 TC 193



 Score = 34.3 bits (75), Expect = 0.074
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C + C S   T+ C   C N C  SC   SG          C SN ++  + +PC  SC 
Sbjct: 180 CQNQCSSACTTMTCRQTCQNTCLGSCNSCSG--------GGCNSNNSNLVVVTPCERSCN 231

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             CR    S+ SST  + +C   C
Sbjct: 232 SGCR----STCSSTSTLSVCIPAC 251



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 23/85 (27%), Positives = 36/85 (42%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P+C + C S   T  C   CSN+C   C   + I       C  C +  S +  +P +C 
Sbjct: 54  PVCMAQCQSSCTTPICQQQCSNQCNQQC---TSITISSGPSCSSCQSACSSACTTP-TCI 109

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCS 502
             C+    S+  +T     CT+ C+
Sbjct: 110 RTCQRNSCSNLCNTGSN-SCTNRCN 133



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/59 (28%), Positives = 21/59 (35%), Gaps = 3/59 (5%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF---CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           P C   C   SC+  C      C+NRC + C        C       CSN  S   + P
Sbjct: 106 PTCIRTCQRNSCSNLCNTGSNSCTNRCNSQCLQICTTPSCTNTCSNSCSNACSNGGNQP 164



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 8/64 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC-TFC----CSNRCGT---SCCPSSGILCCFAILCWCCSNPASGSLH 409
           C S C S   T  C   C    CSN C T   SC       C        C+N  S S  
Sbjct: 95  CQSACSSACTTPTCIRTCQRNSCSNLCNTGSNSCTNRCNSQCLQICTTPSCTNTCSNSCS 154

Query: 410 SPCS 421
           + CS
Sbjct: 155 NACS 158


>U53149-1|AAD31546.1|  328|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 16
           protein.
          Length = 328

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 8/83 (9%)
 Frame = +2

Query: 254 CNSICCSYSC-TLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGS-------LH 409
           CN+ C S +  T +C   C+N+C  SC PSS     ++     C+   SGS         
Sbjct: 166 CNNQCASQNQKTNQCANECNNQCANSCSPSSQ-TSSYSKCVSQCAEQCSGSNTSNNQQCQ 224

Query: 410 SPCSCCICCRLPIWSSTSSTFPV 478
             C    C +     ST++T P+
Sbjct: 225 QQCQSNTCGQYQSTVSTTTTTPI 247


>U46675-1|AAB52645.2|  524|Caenorhabditis elegans Hypothetical
           protein F35A5.4 protein.
          Length = 524

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 4/67 (5%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNR-CGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           P C S C   CS SC  +         C  +C P+    C  A+ C  C+N    S+ S 
Sbjct: 172 PTCASSCMPSCSQSCIQKYEITVEQETCVPACMPACSSACVQAVTCSTCTNNCP-SICSQ 230

Query: 416 CSCCICC 436
            +C   C
Sbjct: 231 ANCIPQC 237


>U00046-1|AAC47044.3| 2560|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 152, isoform a protein.
          Length = 2560

 Score = 30.7 bits (66), Expect = 0.91
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 4/73 (5%)
 Frame = -2

Query: 461 RCWTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCS--- 291
           +CW  W  GS C+  + ++G   +   ++    + S G   W  + C       +CS   
Sbjct: 549 QCWKGW-RGSNCTDKKCAIGCEDRGKCASDGSCKCSSG---WNGENCAIDGCPNQCSGKG 604

Query: 290 -VGCSYRSSKWSC 255
             G   RSS+WSC
Sbjct: 605 ECGMDRRSSEWSC 617


>AB206836-1|BAD91087.1| 2502|Caenorhabditis elegans Ten-1S protein.
          Length = 2502

 Score = 30.7 bits (66), Expect = 0.91
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 4/73 (5%)
 Frame = -2

Query: 461 RCWTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCS--- 291
           +CW  W  GS C+  + ++G   +   ++    + S G   W  + C       +CS   
Sbjct: 491 QCWKGW-RGSNCTDKKCAIGCEDRGKCASDGSCKCSSG---WNGENCAIDGCPNQCSGKG 546

Query: 290 -VGCSYRSSKWSC 255
             G   RSS+WSC
Sbjct: 547 ECGMDRRSSEWSC 559


>AB206835-1|BAD91086.1| 2684|Caenorhabditis elegans Ten-1L protein.
          Length = 2684

 Score = 30.7 bits (66), Expect = 0.91
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 4/73 (5%)
 Frame = -2

Query: 461 RCWTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCS--- 291
           +CW  W  GS C+  + ++G   +   ++    + S G   W  + C       +CS   
Sbjct: 673 QCWKGW-RGSNCTDKKCAIGCEDRGKCASDGSCKCSSG---WNGENCAIDGCPNQCSGKG 728

Query: 290 -VGCSYRSSKWSC 255
             G   RSS+WSC
Sbjct: 729 ECGMDRRSSEWSC 741


>Z83127-1|CAB05630.1|  160|Caenorhabditis elegans Hypothetical
           protein T23F6.1 protein.
          Length = 160

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%)
 Frame = +2

Query: 317 CGTSCCPSSGILC-CFAILCWCCSNPASGSLHSPCSCCICCR 439
           CG +CCPS+   C C    C  C         +  +CC CC+
Sbjct: 74  CGQTCCPSAPPPCSCGTPGCMQCVQQTVLVPVTTTTCCKCCQ 115


>AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical
            protein Y8A9A.2 protein.
          Length = 1360

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +2

Query: 311  NRCGTSCCPSSGI 349
            N CG SCCPS+GI
Sbjct: 1094 NTCGVSCCPSAGI 1106


>AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform a
           protein.
          Length = 4488

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR--MPLLGQQEVPHLLEQQKVQR 289
           ++  H   +QH QQ+Q   R+ +     HQ ++ +QHR    L+ +Q++     QQ  Q+
Sbjct: 155 QIRPHQQQQQHYQQQQQSPRQEVT----HQ-NLYEQHRRQQQLIREQQLYQHQHQQHQQQ 209

Query: 288 RVQL*EQQME 259
           + Q  EQQ +
Sbjct: 210 QQQPQEQQQQ 219


>AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform d
           protein.
          Length = 4369

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR--MPLLGQQEVPHLLEQQKVQR 289
           ++  H   +QH QQ+Q   R+ +     HQ ++ +QHR    L+ +Q++     QQ  Q+
Sbjct: 155 QIRPHQQQQQHYQQQQQSPRQEVT----HQ-NLYEQHRRQQQLIREQQLYQHQHQQHQQQ 209

Query: 288 RVQL*EQQME 259
           + Q  EQQ +
Sbjct: 210 QQQPQEQQQQ 219


>AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin
           (drosophila actin-binding)homolog protein 1, isoform c
           protein.
          Length = 4447

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR--MPLLGQQEVPHLLEQQKVQR 289
           ++  H   +QH QQ+Q   R+ +     HQ ++ +QHR    L+ +Q++     QQ  Q+
Sbjct: 155 QIRPHQQQQQHYQQQQQSPRQEVT----HQ-NLYEQHRRQQQLIREQQLYQHQHQQHQQQ 209

Query: 288 RVQL*EQQME 259
           + Q  EQQ +
Sbjct: 210 QQQPQEQQQQ 219


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/65 (24%), Positives = 28/65 (43%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+  + ++ ++G  Q Q      H+        + H  +Q   Q + Q  +QQ + 
Sbjct: 503 QQQQQQHAQHQQNMSGYPQQQQQPQHPHQHQQPASVPMQHHPQQHPSQHQTQPNQQQQQH 562

Query: 255 HRGYG 241
             GYG
Sbjct: 563 PSGYG 567


>Z68108-15|CAJ58502.1|  582|Caenorhabditis elegans Hypothetical
           protein T05A10.1k protein.
          Length = 582

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 276 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 335

Query: 273 EQQ 265
           +Q+
Sbjct: 336 QQR 338


>Z68108-14|CAA92133.3| 2066|Caenorhabditis elegans Hypothetical
           protein T05A10.1a protein.
          Length = 2066

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-13|CAF31493.1| 2048|Caenorhabditis elegans Hypothetical
           protein T05A10.1f protein.
          Length = 2048

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-12|CAF31492.1| 2101|Caenorhabditis elegans Hypothetical
           protein T05A10.1e protein.
          Length = 2101

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-11|CAF31491.1| 2134|Caenorhabditis elegans Hypothetical
           protein T05A10.1d protein.
          Length = 2134

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-10|CAF31490.1| 1888|Caenorhabditis elegans Hypothetical
           protein T05A10.1g protein.
          Length = 1888

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-9|CAF31489.1| 1927|Caenorhabditis elegans Hypothetical
           protein T05A10.1i protein.
          Length = 1927

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-8|CAF31488.1| 1509|Caenorhabditis elegans Hypothetical
           protein T05A10.1j protein.
          Length = 1509

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z68108-5|CAD44152.2|  725|Caenorhabditis elegans Hypothetical
           protein T05A10.1b protein.
          Length = 725

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 276 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 335

Query: 273 EQQ 265
           +Q+
Sbjct: 336 QQR 338


>U80023-2|AAG24035.1|  204|Caenorhabditis elegans Hypothetical
           protein F07C4.6 protein.
          Length = 204

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +2

Query: 407 HSPCSCCICCRLPIWSSTSSTFPVWICTSV 496
           H P +C +CC+   +S  ++ FP   C SV
Sbjct: 100 HCPKTCGLCCQTSTYSCQNAPFPRLNCASV 129


>U39644-2|AAA80360.2|  966|Caenorhabditis elegans Hypothetical
           protein T10E10.4 protein.
          Length = 966

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 3/77 (3%)
 Frame = +2

Query: 266 CCSYSCTL---RCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           CC   C +      FC S  CG   C S    C   I    CSN         C     C
Sbjct: 403 CCPIRCPVGQNAVGFCSSGSCGVGSCYSKTTCCQEPIKLPVCSNGMIS--QKRCLVAAEC 460

Query: 437 RLPIWSSTSSTFPVWIC 487
            L +  S     P+  C
Sbjct: 461 GLNLECSNGGCCPIPFC 477



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 25/77 (32%), Positives = 28/77 (36%), Gaps = 9/77 (11%)
 Frame = +2

Query: 242 P*PLC-NSICCSYSCTLRCTFCC--------SNRCGTSCCPSSGILCCFAILCWCCSNPA 394
           P P C N+I  S  C+  CT CC           C    CPS G    FAI   C     
Sbjct: 540 PLPTCPNNIASSQRCSGGCTNCCPVGQTCMNGGCCDLPSCPSGG----FAI-SMCTGKCG 594

Query: 395 SGSLHSPCSCCICCRLP 445
           +G       CC   R P
Sbjct: 595 TGFECVNSGCCSLPRCP 611


>U28736-2|AAA68307.1|  620|Caenorhabditis elegans Hypothetical
           protein F26A10.2 protein.
          Length = 620

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/69 (27%), Positives = 29/69 (42%)
 Frame = -1

Query: 513 FSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLG 334
           FS  E     I  G V++ +D    +Q MQ  Q     P   + QHQ  +  Q    +  
Sbjct: 149 FSETEDNDAPITYGIVIQNIDQTQMQQQMQPPQ-----PSQAVPQHQQQLQNQDMQQVQP 203

Query: 333 QQEVPHLLE 307
           QQ+ P  ++
Sbjct: 204 QQQAPSSMQ 212


>AY390537-1|AAQ94949.1|  692|Caenorhabditis elegans SMA-9 class B
           protein.
          Length = 692

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 276 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 335

Query: 273 EQQ 265
           +Q+
Sbjct: 336 QQR 338


>AY389809-1|AAR28681.1|  909|Caenorhabditis elegans zinc finger
           transcription factorSMA-9 protein.
          Length = 909

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H+ SRQ    +Q + +  L   +Q Q   A+Q  +     QQ++  L  QQ +Q++ QL 
Sbjct: 253 HVQSRQMQPSQQSQVQAQLQQQQQLQQQQAQQLSQQQAQQQQQLQQLQLQQFLQQQQQLH 312

Query: 273 EQQ 265
           +Q+
Sbjct: 313 QQR 315


>Z82052-6|CAB04829.4|  327|Caenorhabditis elegans Hypothetical
           protein T25E12.11 protein.
          Length = 327

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = -1

Query: 594 LYFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQ--IHTGNVLEVLD--HMGSRQHM 427
           L+F+ QY LLST K  +   C + L  F ++  + +   I+   ++++    H+ S QHM
Sbjct: 167 LHFLRQYCLLSTEKVQIFIACNEVLYMFLNVVISFLTPFIYIPIMIDIRKNRHLHSPQHM 226


>Z77658-8|CAE17788.1|   79|Caenorhabditis elegans Hypothetical
           protein F14D7.11 protein.
          Length = 79

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +2

Query: 398 GSLHSPCSCCICCRLPIWSSTSSTFPVW--ICTSVC 499
           G   S  +CC+CC+  +  S  S F  W  +C +VC
Sbjct: 45  GCCESCIACCVCCQCCV--SCCSLFTCWAQLCCAVC 78


>Z48241-4|CAA88284.1|  468|Caenorhabditis elegans Hypothetical
           protein C32A3.1b protein.
          Length = 468

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ---QEVPHLLEQQKVQRRVQL 277
           M  +Q  QQ++ + ++ L   +Q Q  M + H+M   GQ   Q        Q++QR  Q+
Sbjct: 349 MQQQQQQQQQEHQRQQMLLQQQQQQQQMQQHHQMNGGGQFATQAHQQAAYMQQMQRMEQI 408

Query: 276 *EQQME 259
             QQ +
Sbjct: 409 RHQQQQ 414



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/67 (23%), Positives = 34/67 (50%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +QQ+Q + R  +   +Q    + +Q R  ++ QQ+     E Q+ Q  +Q  +QQ ++ +
Sbjct: 320 LQQQQNKMRL-MQQQQQEMQRIEQQRRQQIMQQQQQQQQQEHQRQQMLLQQQQQQQQMQQ 378

Query: 249 GYGRSEG 229
            +  + G
Sbjct: 379 HHQMNGG 385


>Z48241-3|CAC42265.1|  490|Caenorhabditis elegans Hypothetical
           protein C32A3.1a protein.
          Length = 490

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ---QEVPHLLEQQKVQRRVQL 277
           M  +Q  QQ++ + ++ L   +Q Q  M + H+M   GQ   Q        Q++QR  Q+
Sbjct: 371 MQQQQQQQQQEHQRQQMLLQQQQQQQQMQQHHQMNGGGQFATQAHQQAAYMQQMQRMEQI 430

Query: 276 *EQQME 259
             QQ +
Sbjct: 431 RHQQQQ 436



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/67 (23%), Positives = 34/67 (50%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +QQ+Q + R  +   +Q    + +Q R  ++ QQ+     E Q+ Q  +Q  +QQ ++ +
Sbjct: 342 LQQQQNKMRL-MQQQQQEMQRIEQQRRQQIMQQQQQQQQQEHQRQQMLLQQQQQQQQMQQ 400

Query: 249 GYGRSEG 229
            +  + G
Sbjct: 401 HHQMNGG 407


>AF241847-1|AAF71523.1|  468|Caenorhabditis elegans LAG-3B protein.
          Length = 468

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ---QEVPHLLEQQKVQRRVQL 277
           M  +Q  QQ++ + ++ L   +Q Q  M + H+M   GQ   Q        Q++QR  Q+
Sbjct: 349 MQQQQQQQQQEHQRQQMLLQQQQQQQQMQQHHQMNGGGQFATQAHQQAAYMQQMQRMEQI 408

Query: 276 *EQQME 259
             QQ +
Sbjct: 409 RHQQQQ 414



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/67 (23%), Positives = 34/67 (50%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +QQ+Q + R  +   +Q    + +Q R  ++ QQ+     E Q+ Q  +Q  +QQ ++ +
Sbjct: 320 LQQQQNKMRL-MQQQQQEMQRIEQQRRQQIMQQQQQQQQQEHQRQQMLLQQQQQQQQMQQ 378

Query: 249 GYGRSEG 229
            +  + G
Sbjct: 379 HHQMNGG 385


>AF241846-1|AAF71522.1|  490|Caenorhabditis elegans LAG-3A protein.
          Length = 490

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ---QEVPHLLEQQKVQRRVQL 277
           M  +Q  QQ++ + ++ L   +Q Q  M + H+M   GQ   Q        Q++QR  Q+
Sbjct: 371 MQQQQQQQQQEHQRQQMLLQQQQQQQQMQQHHQMNGGGQFATQAHQQAAYMQQMQRMEQI 430

Query: 276 *EQQME 259
             QQ +
Sbjct: 431 RHQQQQ 436



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/67 (23%), Positives = 34/67 (50%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +QQ+Q + R  +   +Q    + +Q R  ++ QQ+     E Q+ Q  +Q  +QQ ++ +
Sbjct: 342 LQQQQNKMRL-MQQQQQEMQRIEQQRRQQIMQQQQQQQQQEHQRQQMLLQQQQQQQQMQQ 400

Query: 249 GYGRSEG 229
            +  + G
Sbjct: 401 HHQMNGG 407


>AC006790-9|AAF60735.1|  382|Caenorhabditis elegans Hypothetical
           protein Y49F6B.9 protein.
          Length = 382

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -2

Query: 461 RCWTIWVAGS-ICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKR 297
           +C  +W  G+  CS++ E +    ++     + + S  GC +WG K+    WS+K+
Sbjct: 164 KCRKVWHEGTRTCSKTFEQLKKITEN-EINDLHYMSPTGCTFWGKKQ----WSNKK 214


>AC024781-3|AAK39330.2| 2203|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 85
           protein.
          Length = 2203

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = -1

Query: 432 HMQQEQGE-CREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           H QQ+Q +   +P A  + HQ +M  QH+M  L QQ+     +QQ+ Q+ VQ  ++Q  +
Sbjct: 95  HQQQQQHQNIAQPQA--QHHQMNMFTQHQMLQLMQQQ-----QQQQQQQPVQQIQRQQPI 147


>Z92832-6|CAB07375.2|  572|Caenorhabditis elegans Hypothetical
           protein F31D4.7 protein.
          Length = 572

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/57 (28%), Positives = 28/57 (49%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +L H   RQ  +Q++ E +   +    H    AKQ  + +L Q  +P L+E+   Q+
Sbjct: 2   LLSHGEHRQSFKQKRAEEKRRWSSSGSHHQPQAKQ-SLAVLAQLMLPALIEEHTAQQ 57


>Z81122-3|CAB54313.1| 1076|Caenorhabditis elegans Hypothetical
           protein T13F2.3b protein.
          Length = 1076

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = -1

Query: 438 RQHMQQEQ-GECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH+QQ+Q  +  + +      QH M + H+ P    Q  P   +QQ  Q + Q+  +Q
Sbjct: 178 QQHLQQQQYAQNPQQMHDSPYRQHQMMQMHQHPGHPSQYPPGYPQQQAAQWQQQMYARQ 236


>Z81122-2|CAB03354.1| 1074|Caenorhabditis elegans Hypothetical
           protein T13F2.3a protein.
          Length = 1074

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = -1

Query: 438 RQHMQQEQ-GECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH+QQ+Q  +  + +      QH M + H+ P    Q  P   +QQ  Q + Q+  +Q
Sbjct: 176 QQHLQQQQYAQNPQQMHDSPYRQHQMMQMHQHPGHPSQYPPGYPQQQAAQWQQQMYARQ 234


>AF100306-10|AAC68926.1|  798|Caenorhabditis elegans Hypothetical
           protein T24C4.7 protein.
          Length = 798

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -1

Query: 414 GECREPLAGLEQHQHSMAKQHRMPL-LGQQEVPHLLEQQKVQRRVQL 277
           G+CRE  A L   +  +++QH +P+ +  Q   ++ E +K +  V+L
Sbjct: 122 GDCREVFASLYTLRRHLSQQHELPIEIHLQSFVNIGEFEKFRHLVEL 168


>Z98877-9|CAB63405.1|  348|Caenorhabditis elegans Hypothetical
           protein Y69H2.8 protein.
          Length = 348

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +2

Query: 365 ILCWCCSNPASGSLHSPCSCCICC 436
           +LC  C  PASG  +   + C+ C
Sbjct: 19  LLCTVCGAPASGRRYGAAAACLAC 42


>Z93395-2|CAB07705.1|  905|Caenorhabditis elegans Hypothetical
           protein ZC101.1 protein.
          Length = 905

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           + HQ   A+QH+     QQ+     E+Q+ +R+ Q  +QQ + H
Sbjct: 642 QHHQAQQAQQHQQQQERQQQERQQHERQQQERQQQDRQQQAQQH 685


>Z83112-5|CAB05541.1|  905|Caenorhabditis elegans Hypothetical
           protein ZC101.1 protein.
          Length = 905

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           + HQ   A+QH+     QQ+     E+Q+ +R+ Q  +QQ + H
Sbjct: 642 QHHQAQQAQQHQQQQERQQQERQQHERQQQERQQQDRQQQAQQH 685


>Z81595-8|CAB54305.1|  345|Caenorhabditis elegans Hypothetical
           protein T22H2.6b protein.
          Length = 345

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 3/47 (6%)
 Frame = +2

Query: 257 NSICC---SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSN 388
           N + C   +  C    T C   +    CCP    +CC A +  CC N
Sbjct: 175 NEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCC-ADMLHCCPN 220


>Z81595-7|CAB54304.1|  358|Caenorhabditis elegans Hypothetical
           protein T22H2.6a protein.
          Length = 358

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 3/47 (6%)
 Frame = +2

Query: 257 NSICC---SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSN 388
           N + C   +  C    T C   +    CCP    +CC A +  CC N
Sbjct: 175 NEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCC-ADMLHCCPN 220


>Z49068-2|CAA88855.1|  389|Caenorhabditis elegans Hypothetical
           protein K01C8.2 protein.
          Length = 389

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 11/68 (16%)
 Frame = +2

Query: 269 CSYSCTLRCTF-CCSNRCGTSCCPS---------SGILCCFAILCWCCSNPASGSLHSPC 418
           C  S  +  TF CCS+   TS CPS          G + C   +  C S   S  + S  
Sbjct: 110 CVQSSNVASTFLCCSSSISTSSCPSDFTPAVGSNGGTVSCSPSVSTCPS--GSSCMQSTL 167

Query: 419 -SCCICCR 439
            S  ICCR
Sbjct: 168 NSAFICCR 175


>AL132951-7|CAD89753.2|  608|Caenorhabditis elegans Hypothetical
           protein Y67H2A.10 protein.
          Length = 608

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHS-MAKQHRMPLLGQQEVPHLLEQQK 298
           G   + +  + S QH QQ+Q + ++      Q QHS   +Q +M     Q  PH  +QQ+
Sbjct: 449 GQQQQQMGPLPSLQHPQQQQQQ-QQYHQMPPQPQHSPYPQQQQMHHQMVQHSPHHYQQQQ 507

Query: 297 VQRRVQL*EQQMELHRGYGRS 235
            Q++ Q   QQ      Y +S
Sbjct: 508 QQQQYQQQHQQSPQFPSYQQS 528


>AF078784-2|AAK18966.1|  258|Caenorhabditis elegans Hypothetical
           protein H34I24.1 protein.
          Length = 258

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = -1

Query: 243 GRSEGRCCYQRTQCPAGDINLCSVWRNVLR-YSLSVSHVGWSNQRSSGYCWNSCDCTRFS 67
           G+   +C Y+  +  AGD   C+ ++ +   Y L  S   W N++++G   ++CD  R +
Sbjct: 143 GQKTIKCKYECKEEGAGDD--CADYKLICNLYPLPESADLWWNKQTNGEAGSACDADRHA 200

Query: 66  SN 61
            N
Sbjct: 201 DN 202


>AF016679-7|AAB66161.1|  333|Caenorhabditis elegans Hypothetical
           protein T28C12.6 protein.
          Length = 333

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +2

Query: 317 CGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCCICCR 439
           C TS    SG +C   +    CC+NP+  S  S  S  I CR
Sbjct: 196 CMTSTSCESGTICTNGLEQGSCCTNPSQASCPSVTSMNINCR 237


>Z96047-4|CAB09414.1|  796|Caenorhabditis elegans Hypothetical
           protein DY3.5 protein.
          Length = 796

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 4/70 (5%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV---QL*EQ 268
           +Q  QQ+Q +  +     EQ     A+Q     L QQ+     + Q++Q+++   QL +Q
Sbjct: 397 QQKQQQQQQQIAQQQQLAEQIAAQQAQQREAARLAQQQAQQAQQAQQLQQQIRQQQLQQQ 456

Query: 267 QMELHRG-YG 241
           Q +  +  YG
Sbjct: 457 QQQQQQNQYG 466


>AF003151-17|ABJ99068.1|   99|Caenorhabditis elegans Hypothetical
           protein D1007.19 protein.
          Length = 99

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSN 313
           CNS C  Y+  ++C  CC++
Sbjct: 25  CNSSCAIYTSPVQCVRCCTH 44


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,490,263
Number of Sequences: 27780
Number of extensions: 245315
Number of successful extensions: 1493
Number of sequences better than 10.0: 59
Number of HSP's better than 10.0 without gapping: 1031
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1323
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1395683256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).