SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   193   1e-49
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   193   1e-49
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   193   1e-49
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       193   1e-49
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       193   1e-49
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       193   1e-49
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       193   1e-49
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   193   1e-49
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   193   1e-49
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   193   1e-49
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   188   2e-48
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   134   7e-32
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   134   7e-32
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   132   2e-31
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   132   2e-31
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   132   2e-31
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   111   5e-25
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...   102   2e-22
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    81   6e-16
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    37   0.010
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    37   0.010
Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical pr...    31   0.51 
U58726-4|AAB00578.1|  408|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AF068713-7|AAC17798.2|  359|Caenorhabditis elegans Hypothetical ...    29   3.6  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    28   4.8  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    28   4.8  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    28   4.8  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    28   4.8  
Z79755-8|CAB02113.1|  270|Caenorhabditis elegans Hypothetical pr...    28   6.3  
AF169201-1|AAF01678.1|  270|Caenorhabditis elegans CES-1 protein.      28   6.3  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   6.3  
Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical pr...    27   8.4  
U80030-2|AAG24161.2|  362|Caenorhabditis elegans Serpentine rece...    27   8.4  
AC024805-15|AAK39331.2|  344|Caenorhabditis elegans Hypothetical...    27   8.4  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALP 173



 Score =  132 bits (320), Expect = 2e-31
 Identities = 60/62 (96%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALP 173



 Score =  131 bits (316), Expect = 5e-31
 Identities = 58/62 (93%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 18  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 77

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 78  QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 129



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +1

Query: 202 MVGMGQKDSYVGDEAQSK 255
           MVGMGQKDSYVGDEAQSK
Sbjct: 1   MVGMGQKDSYVGDEAQSK 18


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 48  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 107

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 108 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 159



 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 43/44 (97%), Positives = 44/44 (100%)
 Frame = +1

Query: 124 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 48


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  193 bits (470), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  188 bits (459), Expect = 2e-48
 Identities = 91/113 (80%), Positives = 97/113 (85%), Gaps = 1/113 (0%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK+NREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYV IQAVLSLYASG    +   T   V+ T  P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVNIQAVLSLYASGRTTGIVLDTGDGVTHT-VPIYEGYALP 172



 Score =  127 bits (307), Expect = 6e-30
 Identities = 58/60 (96%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKI 326
           +RGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  134 bits (323), Expect = 7e-32
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKI 326
           +RGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  132 bits (320), Expect = 2e-31
 Identities = 60/62 (96%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKI 326
           +RGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  132 bits (320), Expect = 2e-31
 Identities = 60/62 (96%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 21/22 (95%), Positives = 22/22 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDM 317
           +RGILTLKYPIEHGIVTNWDDM
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDM 83


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  132 bits (319), Expect = 2e-31
 Identities = 60/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (0%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           RG+ +++YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+APLNP  NRE+  
Sbjct: 65  RGLFSIEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRERSA 124

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLR 605
           +I FETFN PA+Y+ +QAVLSLYA+G        S    +   P  KG+A+  +H+++
Sbjct: 125 EIFFETFNVPALYIQMQAVLSLYATGRTTGVVLDSGDGVTHAVPIVKGFAM--KHAIQ 180



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 25/53 (47%), Positives = 37/53 (69%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G +A+S
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAES 63


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  111 bits (266), Expect = 5e-25
 Identities = 54/114 (47%), Positives = 76/114 (66%), Gaps = 1/114 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 422
           ++ R +L + YP+++GIV NWDDM  +W HTF  E L + P+E  +LLTE PLNP +NRE
Sbjct: 62  SQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPLNPNSNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           KM Q+MFE +   ++YVA+QAVL+LYA G+       S    +  CP  +G+AL
Sbjct: 122 KMFQVMFEQYGFNSIYVAVQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFAL 175



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 2/52 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 243
           +VVDNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG+E
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE 60


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score =  102 bits (244), Expect = 2e-22
 Identities = 45/80 (56%), Positives = 56/80 (70%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 80  TVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNTPENREYTAEIMFE 139

Query: 447 TFNTPAMYVAIQAVLSLYAS 506
           +FN P +Y+A+QAVL+L AS
Sbjct: 140 SFNVPGLYIAVQAVLALTAS 159



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36



 Score = 30.7 bits (66), Expect = 0.90
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPI 565
           R  TG+V+D GDGV H +P+
Sbjct: 168 RSLTGLVIDSGDGVTHCIPV 187


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 81.0 bits (191), Expect = 6e-16
 Identities = 39/101 (38%), Positives = 58/101 (57%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 462 AMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           A Y++   VLS +A G        S    ++  P   GYA+
Sbjct: 154 AYYLSKNVVLSCFAQGRTHGLMVDSGATQTSVVPVFDGYAV 194



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical
           protein C27H2.2a protein.
          Length = 906

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -3

Query: 331 CQIFSMSSQLVTIPC-SMGYLRVRIPLCSVPHLLHKSPSVP-YRPSRPD 191
           CQ+FS   QLVT+   SMG +++++ +  +P L  KS + P   P+ P+
Sbjct: 251 CQLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLLASKSSTKPTIAPNPPE 299


>U58726-4|AAB00578.1|  408|Caenorhabditis elegans Hypothetical
           protein T01C8.5 protein.
          Length = 408

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/80 (22%), Positives = 34/80 (42%), Gaps = 3/80 (3%)
 Frame = +3

Query: 300 TNWD-DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA--NREKMTQIMFETFNTPAMY 470
           T WD D +++    F ++L  APE+  ++L     NP      ++  +++ E      ++
Sbjct: 152 TFWDYDNKRVHIEKFLSDLESAPEKSVIILHGCAHNPTGMDPTQEQWKLVAEVIKRKNLF 211

Query: 471 VAIQAVLSLYASGVPPVSCW 530
                    +ASG P    W
Sbjct: 212 TFFDIAYQGFASGDPAADAW 231


>AF068713-7|AAC17798.2|  359|Caenorhabditis elegans Hypothetical
           protein T24A6.11 protein.
          Length = 359

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = +1

Query: 469 TSPSKPCSRCTRPAY 513
           TSPSK CS C RPA+
Sbjct: 6   TSPSKQCSICQRPAF 20


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
            beta protein.
          Length = 1418

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 353  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 478
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1230 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1274



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 149 ASSPAKPALHIPEPLSTTNAATSS 78
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
            beta homolog EGL-8 protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 353  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 478
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 149 ASSPAKPALHIPEPLSTTNAATSS 78
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
            defective protein 8,isoform a protein.
          Length = 1419

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 353  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 478
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1231 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1275



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 149 ASSPAKPALHIPEPLSTTNAATSS 78
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
            defective protein 8,isoform b protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 353  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 478
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 149 ASSPAKPALHIPEPLSTTNAATSS 78
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>Z79755-8|CAB02113.1|  270|Caenorhabditis elegans Hypothetical
           protein F43G9.11 protein.
          Length = 270

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 2/114 (1%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           T+  P++  I+ N D   ++WH      L +  ++     T +  +   + E + +    
Sbjct: 12  TVAPPVDFPIIGNCDFQAQLWH---LMSLHLQMQKSSAASTSSSSSSSTSSENLKKSPSS 68

Query: 447 TFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCP--FTKGYALPPRHSL 602
             NT     +I  +L+  +  VP +       VSS+P P   T GY L    +L
Sbjct: 69  VQNTSVF--SIDNILN--SQKVPKLELENDEDVSSSPSPTCSTTGYTLDSLQNL 118


>AF169201-1|AAF01678.1|  270|Caenorhabditis elegans CES-1 protein.
          Length = 270

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 2/114 (1%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           T+  P++  I+ N D   ++WH      L +  ++     T +  +   + E + +    
Sbjct: 12  TVAPPVDFPIIGNCDFQAQLWH---LMSLHLQMQKSSAASTSSSSSSSTSSENLKKSPSS 68

Query: 447 TFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCP--FTKGYALPPRHSL 602
             NT     +I  +L+  +  VP +       VSS+P P   T GY L    +L
Sbjct: 69  VQNTSVF--SIDNILN--SQKVPKLELENDEDVSSSPSPTCSTTGYTLDSLQNL 118


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +1

Query: 124 KAGFAGDDAPRAVFPSIVGRPRHQG 198
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical
           protein M110.1 protein.
          Length = 499

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +3

Query: 174 RGKAPPSGRDGRYGTEG 224
           RGKA  +GRDGR G EG
Sbjct: 216 RGKAGHTGRDGRPGLEG 232


>U80030-2|AAG24161.2|  362|Caenorhabditis elegans Serpentine
           receptor, class w protein121 protein.
          Length = 362

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 508 PDAYSESTAWMATYMAGVLNVSNMIWVIFSLL 413
           P   S  TAW+     GV N+ N +  IFS+L
Sbjct: 286 PYGLSIGTAWIFLLAPGVYNILNQLASIFSML 317


>AC024805-15|AAK39331.2|  344|Caenorhabditis elegans Hypothetical
           protein Y51H7C.13 protein.
          Length = 344

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +3

Query: 510 VPPVSCWTSATVSSTPCPFTKGYALPP 590
           +PP +  T+ T +  PCP+      PP
Sbjct: 136 IPPTTTTTTTTTTRPPCPYPPATNTPP 162


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,997,136
Number of Sequences: 27780
Number of extensions: 411953
Number of successful extensions: 1627
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1413
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1611
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1385109898
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).