SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF036687-1|AAM75374.1|  173|Caenorhabditis elegans Hypothetical ...    31   0.61 
AF385631-1|AAK84832.1|  671|Caenorhabditis elegans serotonin reu...    30   1.4  
AC024812-6|AAF59549.2|  671|Caenorhabditis elegans Modulation of...    30   1.4  
AF024496-2|AAB70340.1| 1459|Caenorhabditis elegans Hypothetical ...    29   2.4  
Z49067-3|CAA88852.3|  591|Caenorhabditis elegans Hypothetical pr...    28   4.3  
Z34799-8|CAA84319.3|  591|Caenorhabditis elegans Hypothetical pr...    28   4.3  
Z75711-2|CAB00033.2|  425|Caenorhabditis elegans Hypothetical pr...    28   5.7  
AC024844-4|AAK29958.1|  421|Caenorhabditis elegans Hypothetical ...    28   5.7  
AF043699-3|AAB97566.1| 1220|Caenorhabditis elegans Temporarily a...    27   7.5  
Z70683-2|CAA94592.2|  717|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z35604-7|CAA84682.1|  304|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z35598-1|CAA84656.1| 1343|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z19152-7|CAA79539.2|  643|Caenorhabditis elegans Hypothetical pr...    27   9.9  

>AF036687-1|AAM75374.1|  173|Caenorhabditis elegans Hypothetical
           protein C08G9.1 protein.
          Length = 173

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -1

Query: 582 VADVESFEFAFSHQILLKCLLPQQNNNFLCIGRHCTVG 469
           VA V SF FA  HQ+   C     ++N LC G  C +G
Sbjct: 11  VALVISFTFAGGHQVKCFCDRDSCDDNLLCQGDFCFIG 48


>AF385631-1|AAK84832.1|  671|Caenorhabditis elegans serotonin
           reuptake transporter protein.
          Length = 671

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -2

Query: 299 YSLCCICTF*IRHYSSAVGLLVVLQIQSSSAIF 201
           Y +CCICTF    Y++ +   V   I S S I+
Sbjct: 184 YGICCICTFIAIFYNAIIAQAVYFAIVSLSKIW 216


>AC024812-6|AAF59549.2|  671|Caenorhabditis elegans Modulation of
           locomotion defectiveprotein 5 protein.
          Length = 671

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -2

Query: 299 YSLCCICTF*IRHYSSAVGLLVVLQIQSSSAIF 201
           Y +CCICTF    Y++ +   V   I S S I+
Sbjct: 184 YGICCICTFIAIFYNAIIAQAVYFAIVSLSKIW 216


>AF024496-2|AAB70340.1| 1459|Caenorhabditis elegans Hypothetical
           protein ZC178.2 protein.
          Length = 1459

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/66 (28%), Positives = 27/66 (40%)
 Frame = +3

Query: 243 SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKC 422
           SD     P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C
Sbjct: 43  SDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETPC 102

Query: 423 LSELET 440
            SE +T
Sbjct: 103 NSETQT 108



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/66 (28%), Positives = 26/66 (39%)
 Frame = +3

Query: 243 SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKC 422
           SD     P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C
Sbjct: 651 SDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVSSDSTTAGPSSTATNSASSETPC 710

Query: 423 LSELET 440
            SE +T
Sbjct: 711 NSETQT 716



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/66 (28%), Positives = 26/66 (39%)
 Frame = +3

Query: 243 SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKC 422
           SD     P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C
Sbjct: 689 SDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVSSDSTTAGPSSTATNSASSETPC 748

Query: 423 LSELET 440
            SE +T
Sbjct: 749 NSETQT 754



 Score = 28.7 bits (61), Expect = 3.2
 Identities = 19/67 (28%), Positives = 27/67 (40%)
 Frame = +3

Query: 240  KSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKK 419
            K D     P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        
Sbjct: 1098 KYDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETP 1157

Query: 420  CLSELET 440
            C SE +T
Sbjct: 1158 CNSETQT 1164



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 17/59 (28%), Positives = 26/59 (44%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T+T  +     C SE +T
Sbjct: 88  PSSTVTNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSESSETPCNSETQT 146



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C SE +T
Sbjct: 392 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETPCNSETQT 450



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C SE +T
Sbjct: 582 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETPCNSETQT 640



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C SE +T
Sbjct: 1000 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETPCNSETQT 1058



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 19/66 (28%), Positives = 27/66 (40%)
 Frame = +3

Query: 243  SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKC 422
            SD     P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C
Sbjct: 1213 SDSTTAGPSSTVTNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTVTNSASSETPC 1272

Query: 423  LSELET 440
             SE +T
Sbjct: 1273 NSETQT 1278



 Score = 27.5 bits (58), Expect = 7.5
 Identities = 19/66 (28%), Positives = 26/66 (39%)
 Frame = +3

Query: 243 SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKC 422
           SD     P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C
Sbjct: 537 SDSTTPGPSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPC 596

Query: 423 LSELET 440
            SE +T
Sbjct: 597 NSETQT 602



 Score = 27.5 bits (58), Expect = 7.5
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T+T        C SE +T
Sbjct: 1258 PSSTVTNSASSETPCNSETQTSDGTSTMTVSSDSTTAGPSSTVTNSASSETPCNSETQT 1316



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 164 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 222



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 202 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 260



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 240 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 298



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 278 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 336



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 316 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 374



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
           P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 354 PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 412



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 848  PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 906



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 886  PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 944



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 924  PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 982



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 264  PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            P+S  TN+  +  P  S    S   S+  +     TA P+ T T        C SE +T
Sbjct: 962  PSSTATNSASSETPCNSETQTSDGTSTMTVPNDSTTAGPSSTATNSASSETPCNSETQT 1020


>Z49067-3|CAA88852.3|  591|Caenorhabditis elegans Hypothetical
           protein C44F1.1 protein.
          Length = 591

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 20/53 (37%), Positives = 26/53 (49%)
 Frame = -1

Query: 300 IQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLFNCCAH 142
           IQL +HL + N  +   S    + P  I   N  + PLLQS   +RL NC  H
Sbjct: 125 IQLEVHLNIDNKIIVVHSLI--THPFLIAITNDQTEPLLQSIFWNRLLNCDQH 175


>Z34799-8|CAA84319.3|  591|Caenorhabditis elegans Hypothetical
           protein C44F1.1 protein.
          Length = 591

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 20/53 (37%), Positives = 26/53 (49%)
 Frame = -1

Query: 300 IQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLFNCCAH 142
           IQL +HL + N  +   S    + P  I   N  + PLLQS   +RL NC  H
Sbjct: 125 IQLEVHLNIDNKIIVVHSLI--THPFLIAITNDQTEPLLQSIFWNRLLNCDQH 175


>Z75711-2|CAB00033.2|  425|Caenorhabditis elegans Hypothetical
           protein K02B12.3 protein.
          Length = 425

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = +3

Query: 234 YQKSDCRRIM--PNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTL 392
           +   +CRR+   P S G   T   F  R++PS    + S+   +A G  S  VTL
Sbjct: 328 FDTHECRRLYFSPESHGLFVTGIEFVSRTSPSICEDIQSETPGIASGFQSAVVTL 382


>AC024844-4|AAK29958.1|  421|Caenorhabditis elegans Hypothetical
           protein Y65B4A.2 protein.
          Length = 421

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +3

Query: 171 PFNFEEADEKKNCRRRLDLEYYQK 242
           P  F EA+EK+ C +R    YYQ+
Sbjct: 246 PATFFEAEEKRTCMKRCQNIYYQQ 269


>AF043699-3|AAB97566.1| 1220|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 203 protein.
          Length = 1220

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +3

Query: 198 KKNCRRRLDLEYYQKSDCRRIMP 266
           +K C  RL  E + K+ CRRI+P
Sbjct: 96  EKTCFERLHQETFGKTGCRRIVP 118


>Z70683-2|CAA94592.2|  717|Caenorhabditis elegans Hypothetical
           protein F13B12.3 protein.
          Length = 717

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 15/65 (23%), Positives = 33/65 (50%), Gaps = 6/65 (9%)
 Frame = +1

Query: 163 SGNLLTLKKRTRRKIAEDDWIW------STTKSPTAEE*CRIQKVQMQHKLYFRFVLLQA 324
           SG   T+K RTR    EDD  W      ++    + E   ++ +++ + KL+  + +++ 
Sbjct: 7   SGRRKTIKFRTRNFSIEDDKYWIQPSRCTSVDMSSREIINKLNEMEQEEKLFITYDVIER 66

Query: 325 RPRWS 339
            P+++
Sbjct: 67  NPKFA 71


>Z35604-7|CAA84682.1|  304|Caenorhabditis elegans Hypothetical
           protein ZK1058.9 protein.
          Length = 304

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -2

Query: 350 RLAGDHRGRAWSRTNRKYSL 291
           RL  D RG++W +  RKY+L
Sbjct: 39  RLLDDSRGQSWEKLARKYTL 58


>Z35598-1|CAA84656.1| 1343|Caenorhabditis elegans Hypothetical
           protein F10F2.2 protein.
          Length = 1343

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 477 TVGYSVGNLALPKFPI 430
           TVGYS GNL LP  P+
Sbjct: 339 TVGYSFGNLNLPGLPL 354


>Z19152-7|CAA79539.2|  643|Caenorhabditis elegans Hypothetical
           protein B0464.6 protein.
          Length = 643

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +1

Query: 160 QSGNLLTLKKRTRRKIAEDDWIWSTTKSPTAEE*CRIQKV 279
           Q+G LLT  ++ R +     WI +T   P AE   ++ K+
Sbjct: 382 QTGELLTEDQQKRAEFMTRAWIRNTILEPLAEHIDKVNKI 421


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,269,991
Number of Sequences: 27780
Number of extensions: 289109
Number of successful extensions: 867
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 867
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1237082886
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).