SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70684-7|CAA94601.1|  143|Caenorhabditis elegans Hypothetical pr...    89   1e-18
Z92838-1|CAB07406.1|  157|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AL132898-6|CAC14409.1|  187|Caenorhabditis elegans Hypothetical ...    28   4.8  
AL132898-5|CAC14408.1|  316|Caenorhabditis elegans Hypothetical ...    28   4.8  

>Z70684-7|CAA94601.1|  143|Caenorhabditis elegans Hypothetical
           protein F28D1.7 protein.
          Length = 143

 Score = 89.4 bits (212), Expect = 1e-18
 Identities = 40/48 (83%), Positives = 44/48 (91%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN +E+
Sbjct: 49  GIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFVEE 96



 Score = 89.0 bits (211), Expect = 2e-18
 Identities = 40/48 (83%), Positives = 45/48 (93%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVLV+GFGR GHAVGDIPGVRFK+VKVAN SL+AL+K KKERPRS
Sbjct: 96  ENDEVLVSGFGRSGHAVGDIPGVRFKIVKVANTSLIALFKGKKERPRS 143


>Z92838-1|CAB07406.1|  157|Caenorhabditis elegans Hypothetical
           protein T03D8.2 protein.
          Length = 157

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ V    K+PNS  RKC  V+L   G +V A++P  G
Sbjct: 78  GIVLKTVIRHPKKPNSGNRKCAIVRL-STGAEVCAYIPNVG 117


>AL132898-6|CAC14409.1|  187|Caenorhabditis elegans Hypothetical
           protein Y59A8B.9 protein.
          Length = 187

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 176 TLKRTPGMSPTA*PLRPNPATSTSS 250
           T  RTP  +P A P RP P+ S+++
Sbjct: 38  TTMRTPAATPAAPPTRPTPSRSSAA 62


>AL132898-5|CAC14408.1|  316|Caenorhabditis elegans Hypothetical
           protein Y59A8B.7 protein.
          Length = 316

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 176 TLKRTPGMSPTA*PLRPNPATSTSS 250
           T  RTP  +P A P RP P+ S+++
Sbjct: 167 TTMRTPAATPAAPPTRPTPSRSSAA 191


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,209,551
Number of Sequences: 27780
Number of extensions: 258254
Number of successful extensions: 601
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 564
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 601
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1049512662
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).