SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL117202-14|CAB57894.2|  766|Caenorhabditis elegans Hypothetical...    40   6e-04
L15314-3|AAF99986.2|  393|Caenorhabditis elegans Gtp exchange fa...    38   0.003
AJ236896-1|CAB38534.1|  377|Caenorhabditis elegans GRP1 protein ...    38   0.003
AF098501-10|AAC67405.3| 1744|Caenorhabditis elegans Mtm (myotubu...    33   0.073
U28736-2|AAA68307.1|  620|Caenorhabditis elegans Hypothetical pr...    28   2.7  
Z82070-2|CAB04914.1|  199|Caenorhabditis elegans Hypothetical pr...    26   8.4  

>AL117202-14|CAB57894.2|  766|Caenorhabditis elegans Hypothetical
           protein Y47D3A.17a protein.
          Length = 766

 Score = 39.9 bits (89), Expect = 6e-04
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH-CKGFIDLAEVIAVTQAT 92
           G L K    LKG++QRWFVLDS      Y +  E  H C+G I+L E    T  T
Sbjct: 65  GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKT 119


>L15314-3|AAF99986.2|  393|Caenorhabditis elegans Gtp exchange
           factor for arfs protein1 protein.
          Length = 393

 Score = 37.9 bits (84), Expect = 0.003
 Identities = 21/41 (51%), Positives = 25/41 (60%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           GAL   WK+RWFVL   ++ L Y+D M D   KG I LA V
Sbjct: 279 GAL--SWKKRWFVLS--ENCLYYFDQMTDKEPKGIITLANV 315


>AJ236896-1|CAB38534.1|  377|Caenorhabditis elegans GRP1 protein
           protein.
          Length = 377

 Score = 37.9 bits (84), Expect = 0.003
 Identities = 21/41 (51%), Positives = 25/41 (60%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           GAL   WK+RWFVL   ++ L Y+D M D   KG I LA V
Sbjct: 263 GAL--SWKKRWFVLS--ENCLYYFDQMTDKEPKGIITLANV 299


>AF098501-10|AAC67405.3| 1744|Caenorhabditis elegans Mtm
            (myotubularin) family protein 5 protein.
          Length = 1744

 Score = 33.1 bits (72), Expect = 0.073
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
            G+L KRGA LK W  R+FVL     ++ YY+  E+
Sbjct: 1648 GYLSKRGAKLKLWVPRFFVLYPDSPKVYYYEDFEN 1682


>U28736-2|AAA68307.1|  620|Caenorhabditis elegans Hypothetical
           protein F26A10.2 protein.
          Length = 620

 Score = 27.9 bits (59), Expect = 2.7
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 60  SSHFLGGPGAGVACVTAITSAKSMNPLQCES 152
           SS FLGG G G A    +   KS++ ++C+S
Sbjct: 473 SSSFLGGYGTGPAYGQQMIYDKSLDDIECDS 503


>Z82070-2|CAB04914.1|  199|Caenorhabditis elegans Hypothetical
           protein W04E12.2 protein.
          Length = 199

 Score = 26.2 bits (55), Expect = 8.4
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 16  NCTFVDLCVSQRMICHHISWAV 81
           +C F+ L  S + IC H SW V
Sbjct: 86  SCGFLTLLCSNQYICDHHSWIV 107


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,492,582
Number of Sequences: 27780
Number of extensions: 133252
Number of successful extensions: 362
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 362
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 598330768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).