SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   246   9e-66
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   246   9e-66
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       246   9e-66
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       246   9e-66
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       246   9e-66
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   246   9e-66
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   244   2e-65
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       243   7e-65
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   237   2e-63
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   207   4e-54
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   180   7e-46
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   180   7e-46
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   178   2e-45
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   173   8e-44
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   153   9e-38
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   133   6e-32
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   101   2e-22
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    83   8e-17
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    51   4e-07
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    46   2e-05
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    46   2e-05
Z70208-2|CAA94136.1|  304|Caenorhabditis elegans Hypothetical pr...    36   0.022
Z99773-3|CAE11316.1|  305|Caenorhabditis elegans Hypothetical pr...    34   0.050
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    29   1.4  
Z81499-2|CAB04088.1|  598|Caenorhabditis elegans Hypothetical pr...    28   3.3  
AY494976-1|AAR87493.1|  598|Caenorhabditis elegans UNC-122 protein.    28   3.3  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   4.4  
Z77132-5|CAB00863.2| 1423|Caenorhabditis elegans Hypothetical pr...    27   5.8  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    27   5.8  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    27   5.8  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    27   5.8  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    27   5.8  
AC024776-1|AAK68468.1|  338|Caenorhabditis elegans Hypothetical ...    27   5.8  
Z73906-10|CAB54209.1|  530|Caenorhabditis elegans Hypothetical p...    27   7.6  
Z73906-9|CAA98121.1|  571|Caenorhabditis elegans Hypothetical pr...    27   7.6  
Z68011-3|CAA92014.2|  821|Caenorhabditis elegans Hypothetical pr...    27   7.6  
AF067616-11|AAC19194.2|  627|Caenorhabditis elegans Collagen pro...    27   7.6  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  246 bits (601), Expect = 9e-66
 Identities = 111/115 (96%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  244 bits (598), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  243 bits (594), Expect = 7e-65
 Identities = 108/115 (93%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  237 bits (581), Expect = 2e-63
 Identities = 106/113 (93%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK+
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKS 114


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  207 bits (505), Expect = 4e-54
 Identities = 93/97 (95%), Positives = 95/97 (97%)
 Frame = +2

Query: 137 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVT 316
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTLKYPIEHGIVT
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 64

Query: 317 NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 101


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  180 bits (437), Expect = 7e-46
 Identities = 82/86 (95%), Positives = 84/86 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKI 340
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  180 bits (437), Expect = 7e-46
 Identities = 82/86 (95%), Positives = 84/86 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKI 340
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  178 bits (434), Expect = 2e-45
 Identities = 81/86 (94%), Positives = 84/86 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKI 340
           SKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  173 bits (420), Expect = 8e-44
 Identities = 78/83 (93%), Positives = 81/83 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDM 331
           SKRGILTLKYPIEHGIVTNWDDM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDM 83


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  153 bits (370), Expect = 9e-38
 Identities = 68/71 (95%), Positives = 69/71 (97%)
 Frame = +2

Query: 215 MVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
           MVGMGQKDSYVGD  +SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 60

Query: 395 LLTEAPLNPKA 427
           LLTEAPLNPKA
Sbjct: 61  LLTEAPLNPKA 71


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  133 bits (322), Expect = 6e-32
 Identities = 57/106 (53%), Positives = 79/106 (74%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G   +S RG+ ++
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAESNRGLFSI 70

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+APLNP
Sbjct: 71  EYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNP 116


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score =  101 bits (243), Expect = 2e-22
 Identities = 52/110 (47%), Positives = 71/110 (64%), Gaps = 3/110 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM-VGMGQ-KDSYVGDGHKSKRGIL 280
           +VVDNG+G  K G+AG + P  +FPS+VGRP  +    VG  + KD  VG+     R +L
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEECSQLRQML 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKA 427
            + YP+++GIV NWDDM  +W HTF  E L + P+E  +LLTE PLNP +
Sbjct: 69  DINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPLNPNS 118


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 83.4 bits (197), Expect = 8e-17
 Identities = 48/125 (38%), Positives = 64/125 (51%), Gaps = 13/125 (10%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI------VGRPRHQG------VMVGM 226
           M   ++ A V+DNG+G  K G+AG+  P+ + PS       V     Q       V  G+
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAIAVKDKVASSNSQAMRWNNRVGAGI 60

Query: 227 GQKDSYVGDGHKSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
              D ++GD   S      T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLT
Sbjct: 61  DDLDFFIGDEALSPAATNYTVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLT 120

Query: 404 EAPLN 418
           E PLN
Sbjct: 121 EPPLN 125


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 51.2 bits (117), Expect = 4e-07
 Identities = 39/133 (29%), Positives = 62/133 (46%), Gaps = 17/133 (12%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK--S 265
           +EV+ LV D GS   + GFAG++ P+   PS +             Q+    GD  K  +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYIAVQEALPDDTIEKQEAMEEGDNSKVQT 68

Query: 266 KR------GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 400
           KR      G   +  P         ++ G++ +W+  EKI  H++ N L   P EHPVL 
Sbjct: 69  KREKNFFIGTTKIIVPRARTNMESFMKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLF 128

Query: 401 TEAPLNPKALQRR 439
           +E+  N +A + +
Sbjct: 129 SESSWNDRARREK 141


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     D    K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQEECSD----KFSL 57

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTF 355
             ++ PIE G V NWD  ++IW  TF
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF 82


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     D    K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQEECSD----KFSL 57

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTF 355
             ++ PIE G V NWD  ++IW  TF
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF 82


>Z70208-2|CAA94136.1|  304|Caenorhabditis elegans Hypothetical
           protein F54B11.2 protein.
          Length = 304

 Score = 35.5 bits (78), Expect = 0.022
 Identities = 28/79 (35%), Positives = 32/79 (40%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AA 369
           G A P+G DG  GT G         +  YP+P  P         G  G D AS      A
Sbjct: 193 GPAGPAGNDGAAGTPG---PDGPAGESTYPEPAAPGPAGPPGPAGPPGPDGASPTAAPGA 249

Query: 370 CRPRGTPRPAY*GSPQPQG 426
             P G P PA  G+P P G
Sbjct: 250 AGPPGPPGPA--GAPGPDG 266


>Z99773-3|CAE11316.1|  305|Caenorhabditis elegans Hypothetical
           protein H06A10.2 protein.
          Length = 305

 Score = 34.3 bits (75), Expect = 0.050
 Identities = 28/79 (35%), Positives = 32/79 (40%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AA 369
           G A P+G DG  GT G         +  YP+P  P         G  G D AS      A
Sbjct: 194 GPAGPAGNDGAAGTPG---PDGPAGESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGA 250

Query: 370 CRPRGTPRPAY*GSPQPQG 426
             P G P PA  G+P P G
Sbjct: 251 AGPPGPPGPA--GAPGPDG 267


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 1/76 (1%)
 Frame = -2

Query: 312 TIPCSMGYLRVRIPLLLLCPSPT*ESFCPIPTITP*WRGLPTIEGN-TARGASSPAKPAL 136
           T+  S        PL++   S    S     TITP  +G+PT   N      S+P  P  
Sbjct: 451 TLTLSQSPTPTSTPLVVSSSSSGSSSTVVTSTITPSTQGVPTSTSNQPTPSTSNPTTPKS 510

Query: 135 HIPEPLSTTNAATSSS 88
            +    STT A +++S
Sbjct: 511 TVTASPSTTGATSTAS 526


>Z81499-2|CAB04088.1|  598|Caenorhabditis elegans Hypothetical
           protein F11C3.2 protein.
          Length = 598

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 373 RPRGTPRPAY*GSPQPQGPTEEKMTPDSW-FENNSTRPAMYRRP 501
           RP  TP+     SP    PTE+ +T D W  E N + P  Y  P
Sbjct: 239 RPPPTPKRKTTQSPIHVVPTEKNITMDDWNAEMNISTPKPYMGP 282


>AY494976-1|AAR87493.1|  598|Caenorhabditis elegans UNC-122 protein.
          Length = 598

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 373 RPRGTPRPAY*GSPQPQGPTEEKMTPDSW-FENNSTRPAMYRRP 501
           RP  TP+     SP    PTE+ +T D W  E N + P  Y  P
Sbjct: 239 RPPPTPKRKTTQSPIHVVPTEKNITMDDWNAEMNISTPKPYMGP 282


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 4.4
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +2

Query: 137 KAGFAGDDAPRAVFPSIVGRPRHQG 211
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>Z77132-5|CAB00863.2| 1423|Caenorhabditis elegans Hypothetical
           protein F54D1.6 protein.
          Length = 1423

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 12/48 (25%), Positives = 24/48 (50%)
 Frame = +2

Query: 239 SYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 382
           +Y GDG +    +   ++P  +G V  +DD   +   ++   ++V PE
Sbjct: 717 TYAGDGRQYNENLA--RFPTHYGQVCCYDDQGHLMQTSYQPVIKVTPE 762


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
           beta protein.
          Length = 1418

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 162 ASSPAKPALHIPEPLSTTNAATSS 91
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
           beta homolog EGL-8 protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 162 ASSPAKPALHIPEPLSTTNAATSS 91
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
           defective protein 8,isoform a protein.
          Length = 1419

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 162 ASSPAKPALHIPEPLSTTNAATSS 91
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
           defective protein 8,isoform b protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -2

Query: 162 ASSPAKPALHIPEPLSTTNAATSS 91
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AC024776-1|AAK68468.1|  338|Caenorhabditis elegans Hypothetical
           protein Y41D4B.18 protein.
          Length = 338

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = -2

Query: 255 PSPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 91
           PS T  +  P PT  P   G PT        A+SP   +    +P+S++ ++TSS
Sbjct: 237 PSSTASTSTPAPTNLPTTTGAPTNSTTNPPTATSPKTSS----QPVSSSTSSTSS 287


>Z73906-10|CAB54209.1|  530|Caenorhabditis elegans Hypothetical
           protein D2030.9b protein.
          Length = 530

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
 Frame = +2

Query: 290 YPIEHGIVTN-WDDMEKIWHHTFYNELRVAPEEHP 391
           +P E+ IV++ WD +  +W      E  +AP +HP
Sbjct: 452 HPTENEIVSSAWDGVTTVWTWDERQEGVIAPYDHP 486


>Z73906-9|CAA98121.1|  571|Caenorhabditis elegans Hypothetical
           protein D2030.9a protein.
          Length = 571

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
 Frame = +2

Query: 290 YPIEHGIVTN-WDDMEKIWHHTFYNELRVAPEEHP 391
           +P E+ IV++ WD +  +W      E  +AP +HP
Sbjct: 493 HPTENEIVSSAWDGVTTVWTWDERQEGVIAPYDHP 527


>Z68011-3|CAA92014.2|  821|Caenorhabditis elegans Hypothetical
           protein T21B6.3 protein.
          Length = 821

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +1

Query: 373 RPRGTPRPAY*GSPQPQGPTEEKMTP 450
           RP+  P P    +P PQ P +E+ TP
Sbjct: 384 RPKADPCPGGFCAPVPQAPQQERPTP 409


>AF067616-11|AAC19194.2|  627|Caenorhabditis elegans Collagen
           protein 99 protein.
          Length = 627

 Score = 27.1 bits (57), Expect = 7.6
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQEQKRYPDPQIP 294
           G   P G  G +GTEG   ++  +  K YP P  P
Sbjct: 510 GPPGPMGLRGPHGTEGETGKQGPEGSKGYPGPMGP 544


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,931,451
Number of Sequences: 27780
Number of extensions: 314074
Number of successful extensions: 1198
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 1096
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1191
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 956602620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).