SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF101316-1|AAC69231.1|  684|Caenorhabditis elegans Hypothetical ...    31   0.39 
U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical pr...    29   2.7  
AL021497-8|CAA16409.1|  334|Caenorhabditis elegans Hypothetical ...    29   2.7  
Z77665-4|CAB01222.1|  126|Caenorhabditis elegans Hypothetical pr...    28   4.8  
U56961-6|AAK39299.1|  497|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z93398-9|CAN99698.1| 1497|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-8|CAJ80823.1| 3424|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-7|CAD90188.2| 4955|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-6|CAD90187.2| 4944|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-5|CAD90186.2| 3436|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-4|CAH04743.1| 4410|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-3|CAH04742.1| 3322|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-2|CAH04741.1| 3323|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z93398-1|CAH04740.1| 3405|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-9|CAN99699.1| 1497|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-8|CAJ80815.1| 3424|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-7|CAD90177.2| 4955|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-6|CAD90176.2| 4944|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-5|CAD90175.2| 3436|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-4|CAH04711.1| 4410|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-3|CAH04710.1| 3322|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-2|CAH04709.1| 3323|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92788-1|CAH04708.1| 3405|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z75955-16|CAN86627.1|  483|Caenorhabditis elegans Hypothetical p...    27   6.3  
Z75955-15|CAB00117.2|  484|Caenorhabditis elegans Hypothetical p...    27   6.3  
AL031637-4|CAD90184.2| 4955|Caenorhabditis elegans Hypothetical ...    27   6.3  
AL031637-3|CAD90183.2| 4944|Caenorhabditis elegans Hypothetical ...    27   6.3  
AL031637-2|CAH04759.1| 4410|Caenorhabditis elegans Hypothetical ...    27   6.3  
AJ505905-1|CAD44516.1| 3522|Caenorhabditis elegans VAB-10B prote...    27   6.3  
AJ505904-1|CAD44515.1| 3436|Caenorhabditis elegans VAB-10A prote...    27   6.3  
AJ505903-1|CAD44514.1| 3436|Caenorhabditis elegans VAB-10A prote...    27   6.3  
AJ505816-1|CAD44324.1| 4944|Caenorhabditis elegans VAB-10B prote...    27   6.3  
AJ505815-1|CAD44323.1| 3436|Caenorhabditis elegans VAB-10A prote...    27   6.3  
U13876-14|AAA21168.1| 2500|Caenorhabditis elegans Not-like (yeas...    27   8.4  

>AF101316-1|AAC69231.1|  684|Caenorhabditis elegans Hypothetical
           protein F52F10.3 protein.
          Length = 684

 Score = 31.5 bits (68), Expect = 0.39
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = -2

Query: 258 NISCNTSSVCSFKFVNFVIALSKSCSTPIQESI-VFQDSSPYSVFQKTTPYCIR 100
           NISC+  SV S   +   + L  SCS   Q+ I +F   SPY  F     YC++
Sbjct: 113 NISCSAPSVYSNVTLRMAVCLPDSCSH--QDMINIFNQLSPYP-FTACDAYCVK 163


>U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical
           protein T04G9.1 protein.
          Length = 1610

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 22/88 (25%), Positives = 41/88 (46%)
 Frame = +1

Query: 262 KVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR* 441
           K+++++    Q   N P     AQV + L ST    + +L+ D ++  A +SKS   +  
Sbjct: 299 KIQQIQSHFVQN--NLPSPARGAQVSNALPSTSSSESSKLTDDIKQEQAMISKSSLEHP- 355

Query: 442 AFRGPIMQQLLQRREMFCSDENHLLWNK 525
             R    ++ L + +M    +   LWN+
Sbjct: 356 --RQQSTREFLMQNQM--GQKARSLWNQ 379


>AL021497-8|CAA16409.1|  334|Caenorhabditis elegans Hypothetical
           protein Y51A2D.12 protein.
          Length = 334

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = -1

Query: 244 YFIGMFI*ICKFCNCFV*ILLNPNTGIH-CFSRFQS 140
           + +G F+ +C + N FV + +  NTG+   FS F S
Sbjct: 45  FCVGFFMNLCTYLNSFVTLRIPQNTGVQGTFSSFYS 80


>Z77665-4|CAB01222.1|  126|Caenorhabditis elegans Hypothetical
           protein K02E11.5 protein.
          Length = 126

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%)
 Frame = -3

Query: 152 KIPV-PTVFFKKRRLIVLEQRTTYDFTKY 69
           KIP  PT + K ++++V+++   YDF KY
Sbjct: 82  KIPSGPTNYNKNKKMLVIKKMRLYDFGKY 110


>U56961-6|AAK39299.1|  497|Caenorhabditis elegans Hypothetical
           protein T19D7.1 protein.
          Length = 497

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 45  LEYTYLFKIFGKVIRSSLF*YNKASFFEKHCRDWNLEKQWIPVLGLSR-I*TKQLQNLQI 221
           + +T+L+  F K+ +   F  +K+S  +K  ++W +  +   +L LSR +       ++I
Sbjct: 138 MSWTHLYSYFQKIFQYRKFDNSKSSCQKKLLKNWKIFLKIRKMLSLSRNVYIIATIYVKI 197

Query: 222 *MNIPMKYCKI 254
             N+  K CK+
Sbjct: 198 YKNLHYKMCKL 208


>Z93398-9|CAN99698.1| 1497|Caenorhabditis elegans Hypothetical protein
            ZK1151.1i protein.
          Length = 1497

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1368 QQQLDMLIAEYTNLQEHTQAI 1388


>Z93398-8|CAJ80823.1| 3424|Caenorhabditis elegans Hypothetical protein
            ZK1151.1h protein.
          Length = 3424

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1241 QQQLDMLIAEYTNLQEHTQAI 1261


>Z93398-7|CAD90188.2| 4955|Caenorhabditis elegans Hypothetical protein
            ZK1151.1c protein.
          Length = 4955

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z93398-6|CAD90187.2| 4944|Caenorhabditis elegans Hypothetical protein
            ZK1151.1b protein.
          Length = 4944

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z93398-5|CAD90186.2| 3436|Caenorhabditis elegans Hypothetical protein
            ZK1151.1a protein.
          Length = 3436

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z93398-4|CAH04743.1| 4410|Caenorhabditis elegans Hypothetical protein
            ZK1151.1g protein.
          Length = 4410

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z93398-3|CAH04742.1| 3322|Caenorhabditis elegans Hypothetical protein
            ZK1151.1f protein.
          Length = 3322

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z93398-2|CAH04741.1| 3323|Caenorhabditis elegans Hypothetical protein
            ZK1151.1e protein.
          Length = 3323

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1140 QQQLDMLIAEYTNLQEHTQAI 1160


>Z93398-1|CAH04740.1| 3405|Caenorhabditis elegans Hypothetical protein
            ZK1151.1d protein.
          Length = 3405

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1222 QQQLDMLIAEYTNLQEHTQAI 1242


>Z92788-9|CAN99699.1| 1497|Caenorhabditis elegans Hypothetical protein
            ZK1151.1i protein.
          Length = 1497

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1368 QQQLDMLIAEYTNLQEHTQAI 1388


>Z92788-8|CAJ80815.1| 3424|Caenorhabditis elegans Hypothetical protein
            ZK1151.1h protein.
          Length = 3424

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1241 QQQLDMLIAEYTNLQEHTQAI 1261


>Z92788-7|CAD90177.2| 4955|Caenorhabditis elegans Hypothetical protein
            ZK1151.1c protein.
          Length = 4955

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z92788-6|CAD90176.2| 4944|Caenorhabditis elegans Hypothetical protein
            ZK1151.1b protein.
          Length = 4944

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z92788-5|CAD90175.2| 3436|Caenorhabditis elegans Hypothetical protein
            ZK1151.1a protein.
          Length = 3436

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z92788-4|CAH04711.1| 4410|Caenorhabditis elegans Hypothetical protein
            ZK1151.1g protein.
          Length = 4410

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z92788-3|CAH04710.1| 3322|Caenorhabditis elegans Hypothetical protein
            ZK1151.1f protein.
          Length = 3322

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>Z92788-2|CAH04709.1| 3323|Caenorhabditis elegans Hypothetical protein
            ZK1151.1e protein.
          Length = 3323

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1140 QQQLDMLIAEYTNLQEHTQAI 1160


>Z92788-1|CAH04708.1| 3405|Caenorhabditis elegans Hypothetical protein
            ZK1151.1d protein.
          Length = 3405

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1222 QQQLDMLIAEYTNLQEHTQAI 1242


>Z75955-16|CAN86627.1|  483|Caenorhabditis elegans Hypothetical
           protein R07B7.9b protein.
          Length = 483

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%)
 Frame = +1

Query: 304 NTPLTPEQAQVVSELASTIKQNAFQLST----DHRELHATVSKSGQVYR*AFR 450
           N P TPE  + + EL  + +  ++++      D RE    V   G  Y  AFR
Sbjct: 359 NRPGTPESRKQLDELCDSYRNASYEIQNEGKFDDREFTVVVQPFGTEYTDAFR 411


>Z75955-15|CAB00117.2|  484|Caenorhabditis elegans Hypothetical
           protein R07B7.9a protein.
          Length = 484

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%)
 Frame = +1

Query: 304 NTPLTPEQAQVVSELASTIKQNAFQLST----DHRELHATVSKSGQVYR*AFR 450
           N P TPE  + + EL  + +  ++++      D RE    V   G  Y  AFR
Sbjct: 360 NRPGTPESRKQLDELCDSYRNASYEIQNEGKFDDREFTVVVQPFGTEYTDAFR 412


>AL031637-4|CAD90184.2| 4955|Caenorhabditis elegans Hypothetical
            protein ZK1151.1c protein.
          Length = 4955

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AL031637-3|CAD90183.2| 4944|Caenorhabditis elegans Hypothetical
            protein ZK1151.1b protein.
          Length = 4944

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AL031637-2|CAH04759.1| 4410|Caenorhabditis elegans Hypothetical
            protein ZK1151.1g protein.
          Length = 4410

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AJ505905-1|CAD44516.1| 3522|Caenorhabditis elegans VAB-10B protein
            protein.
          Length = 3522

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AJ505904-1|CAD44515.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AJ505903-1|CAD44514.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AJ505816-1|CAD44324.1| 4944|Caenorhabditis elegans VAB-10B protein
            protein.
          Length = 4944

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>AJ505815-1|CAD44323.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 182  EQDLDKAITKFTNLNEHTDEV 244
            +Q LD  I ++TNL EHT  +
Sbjct: 1253 QQQLDMLIAEYTNLQEHTQAI 1273


>U13876-14|AAA21168.1| 2500|Caenorhabditis elegans Not-like (yeast
            ccr4/not complexcomponent) protein 1 protein.
          Length = 2500

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +1

Query: 304  NTPLTPEQAQVVSELASTIKQNAFQLSTD 390
            +T   PE  Q++ + A+TI Q+  +LST+
Sbjct: 1557 STAANPEMKQMIEDAAATITQDNVELSTN 1585


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,789,268
Number of Sequences: 27780
Number of extensions: 272799
Number of successful extensions: 771
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 770
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1049512662
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).