SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF106584-1|AAC78221.1|  360|Caenorhabditis elegans Hypothetical ...    30   1.4  
U80437-14|ABO52817.1| 1590|Caenorhabditis elegans Histone methyl...    29   2.5  
U80437-13|ABO52816.1| 1604|Caenorhabditis elegans Histone methyl...    29   2.5  
AC024845-7|AAF60849.2|  422|Caenorhabditis elegans Hypothetical ...    29   2.5  

>AF106584-1|AAC78221.1|  360|Caenorhabditis elegans Hypothetical
           protein F54A5.2 protein.
          Length = 360

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = -2

Query: 445 LSGTSPWHSYKDRFRTV*YAVPLKSTSVSFSNAIRLSTDEACISSNSAKGAKLSALLFML 266
           +S  SP  + +  FR    AV    TS + S+   +STD +  SS+S+  A LS L F+L
Sbjct: 295 VSDISPPIAVRTSFRLKREAVARLETSQTTSS---VSTDSSTNSSSSSSSANLSFLFFLL 351

Query: 265 TV 260
            V
Sbjct: 352 IV 353


>U80437-14|ABO52817.1| 1590|Caenorhabditis elegans Histone
           methyltransferase-likeprotein 1, isoform b protein.
          Length = 1590

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 15/43 (34%), Positives = 18/43 (41%)
 Frame = +1

Query: 406 TCPYTSAKGWCPRGT*LSGGFLQFRPQSSNAPCMNQMFATKRY 534
           TC      G C   T ++   L   P S    C NQ FA K+Y
Sbjct: 626 TCECHRTGGNCSDNTCVNRAMLTECPSSCQVKCKNQRFAKKKY 668


>U80437-13|ABO52816.1| 1604|Caenorhabditis elegans Histone
           methyltransferase-likeprotein 1, isoform a protein.
          Length = 1604

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 15/43 (34%), Positives = 18/43 (41%)
 Frame = +1

Query: 406 TCPYTSAKGWCPRGT*LSGGFLQFRPQSSNAPCMNQMFATKRY 534
           TC      G C   T ++   L   P S    C NQ FA K+Y
Sbjct: 640 TCECHRTGGNCSDNTCVNRAMLTECPSSCQVKCKNQRFAKKKY 682


>AC024845-7|AAF60849.2|  422|Caenorhabditis elegans Hypothetical
           protein Y65B4BL.1 protein.
          Length = 422

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 10/36 (27%), Positives = 22/36 (61%)
 Frame = -2

Query: 361 SFSNAIRLSTDEACISSNSAKGAKLSALLFMLTVLL 254
           +F N    S+   C SSN++ G   S++L ++++++
Sbjct: 123 AFGNNSSSSSSAGCFSSNNSSGGLFSSILILISIII 158


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,399,370
Number of Sequences: 27780
Number of extensions: 264645
Number of successful extensions: 652
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 596
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 652
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1258229602
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).