SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82059-12|CAB04880.1|  622|Caenorhabditis elegans Hypothetical p...    81   6e-16
U20783-1|AAC46845.1|  535|Caenorhabditis elegans unknown protein.      81   6e-16
AL032665-2|CAA21772.1|  622|Caenorhabditis elegans Hypothetical ...    81   6e-16
Z75537-2|CAA99835.1|  622|Caenorhabditis elegans Hypothetical pr...    63   2e-10
U10414-9|AAA19072.1|  712|Caenorhabditis elegans Hypothetical pr...    48   4e-06
U97407-4|AAB52482.3| 1272|Caenorhabditis elegans P-glycoprotein ...    36   0.028
EF205592-1|ABM92304.1| 1272|Caenorhabditis elegans ABC transport...    36   0.028
U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis...    35   0.037
Z77666-6|CAB01232.1| 1321|Caenorhabditis elegans Hypothetical pr...    35   0.049
X65054-1|CAA46190.1| 1321|Caenorhabditis elegans P-glycoprotein ...    35   0.049
U66260-1|AAB07021.1| 1540|Caenorhabditis elegans multidrug resis...    32   0.26 
U41554-9|AAP82650.1|  328|Caenorhabditis elegans Multidrug resis...    32   0.26 
U41554-8|ABA03118.1| 1534|Caenorhabditis elegans Multidrug resis...    32   0.26 
U41554-7|AAM69107.1| 1534|Caenorhabditis elegans Multidrug resis...    32   0.26 
U41554-6|AAL06032.1| 1534|Caenorhabditis elegans Multidrug resis...    32   0.26 
U41554-5|AAD31550.2| 1528|Caenorhabditis elegans Multidrug resis...    32   0.26 
AB199793-1|BAD88409.1| 1534|Caenorhabditis elegans multidrug res...    32   0.26 
Z49126-5|CAA88940.3| 1270|Caenorhabditis elegans Hypothetical pr...    32   0.35 
U28928-7|AAA68339.1|  665|Caenorhabditis elegans Peroxisomal mem...    32   0.35 
Z93782-3|CAB07855.1| 1294|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z81484-12|CAB03973.1| 1294|Caenorhabditis elegans Hypothetical p...    31   0.46 
Z70268-5|CAJ85767.2| 1204|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z70268-4|CAA94220.3| 1263|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z70268-3|CAA94219.3| 1263|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z66567-9|CAA91495.1| 1268|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z66562-7|CAA91467.1| 1268|Caenorhabditis elegans Hypothetical pr...    31   0.46 
Z66562-6|CAA91463.1| 1266|Caenorhabditis elegans Hypothetical pr...    31   0.46 
X65055-1|CAA46191.1| 1254|Caenorhabditis elegans P-glycoprotein ...    31   0.46 
AL110487-1|CAB54424.1|  610|Caenorhabditis elegans Hypothetical ...    31   0.46 
U66261-1|AAB07022.1| 1525|Caenorhabditis elegans multidrug resis...    31   0.61 
U41554-4|AAA83299.2| 1525|Caenorhabditis elegans Multidrug resis...    31   0.61 
Z81049-5|CAE17733.2|  197|Caenorhabditis elegans Hypothetical pr...    26   0.67 
Z70265-1|CAA94202.1| 1283|Caenorhabditis elegans Hypothetical pr...    31   0.80 
U41015-1|AAA82317.2| 1396|Caenorhabditis elegans Multidrug resis...    30   1.1  
Z93385-2|CAB07637.1|  358|Caenorhabditis elegans Hypothetical pr...    30   1.4  
AL032637-11|CAA21622.3| 1119|Caenorhabditis elegans Hypothetical...    30   1.4  
Z83319-4|CAB05909.1|  734|Caenorhabditis elegans Hypothetical pr...    29   2.4  
U46673-6|AAC48149.2| 1382|Caenorhabditis elegans P-glycoprotein ...    29   2.4  
U28928-8|AAA68340.1|  661|Caenorhabditis elegans Peroxisomal mem...    29   3.2  
Z82078-7|CAB04947.3|  801|Caenorhabditis elegans Hypothetical pr...    28   4.3  
AF497514-1|AAM33381.1|  801|Caenorhabditis elegans heavy metal t...    28   4.3  
AF497513-1|AAM33380.1|  801|Caenorhabditis elegans heavy metal t...    28   4.3  
AF490977-1|AAQ06435.1|  801|Caenorhabditis elegans ABC6 protein ...    28   4.3  
Z68113-4|CAA92148.2| 1503|Caenorhabditis elegans Hypothetical pr...    28   5.7  
AF003138-6|ABE73338.1| 1551|Caenorhabditis elegans Abc transport...    28   5.7  
AF098999-6|AAC68724.2|  787|Caenorhabditis elegans Half transpor...    27   7.5  
AF000264-2|AAC71121.1|  761|Caenorhabditis elegans Half transpor...    27   7.5  
Z67882-1|CAA91801.1| 1327|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z48783-2|CAC42295.1|  805|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z48783-1|CAA88701.1|  780|Caenorhabditis elegans Hypothetical pr...    27   9.9  
AY519858-1|AAR89639.1| 1327|Caenorhabditis elegans P-glycoprotei...    27   9.9  
AL132902-3|CAC14419.1|  271|Caenorhabditis elegans Hypothetical ...    27   9.9  
AL132902-2|CAB81987.1|  271|Caenorhabditis elegans Hypothetical ...    27   9.9  
AL008867-2|CAE17750.1|  763|Caenorhabditis elegans Hypothetical ...    27   9.9  
AF233652-1|AAF63475.1|  780|Caenorhabditis elegans RFX-type tran...    27   9.9  
AF226156-1|AAF61564.1|  805|Caenorhabditis elegans RFX-like tran...    27   9.9  
AF101313-1|AAC69223.1| 1802|Caenorhabditis elegans Abc transport...    27   9.9  
AF078790-4|AAC26932.1|  311|Caenorhabditis elegans Hypothetical ...    27   9.9  

>Z82059-12|CAB04880.1|  622|Caenorhabditis elegans Hypothetical
           protein T27E9.7 protein.
          Length = 622

 Score = 81.0 bits (191), Expect = 6e-16
 Identities = 34/69 (49%), Positives = 53/69 (76%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P   D ++ + +ITF+G E++ DT LELN GRRYGL+GLNG GKS+++ A+  +E+PIPE
Sbjct: 77  PKGLDHRVESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPE 136

Query: 431 HIDIFHLTR 457
            +D++ ++R
Sbjct: 137 SVDMYLVSR 145


>U20783-1|AAC46845.1|  535|Caenorhabditis elegans unknown protein.
          Length = 535

 Score = 81.0 bits (191), Expect = 6e-16
 Identities = 34/69 (49%), Positives = 53/69 (76%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P   D ++ + +ITF+G E++ DT LELN GRRYGL+GLNG GKS+++ A+  +E+PIPE
Sbjct: 76  PKGLDHRVESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPE 135

Query: 431 HIDIFHLTR 457
            +D++ ++R
Sbjct: 136 SVDMYLVSR 144


>AL032665-2|CAA21772.1|  622|Caenorhabditis elegans Hypothetical
           protein T27E9.7 protein.
          Length = 622

 Score = 81.0 bits (191), Expect = 6e-16
 Identities = 34/69 (49%), Positives = 53/69 (76%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P   D ++ + +ITF+G E++ DT LELN GRRYGL+GLNG GKS+++ A+  +E+PIPE
Sbjct: 77  PKGLDHRVESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPE 136

Query: 431 HIDIFHLTR 457
            +D++ ++R
Sbjct: 137 SVDMYLVSR 145


>Z75537-2|CAA99835.1|  622|Caenorhabditis elegans Hypothetical
           protein F18E2.2 protein.
          Length = 622

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 31/64 (48%), Positives = 40/64 (62%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S DIKI NF I+  G  L     L +  GRRYGLVG NG GK++LL  +  R++ IP HI
Sbjct: 77  SMDIKIENFDISAQGKLLFDKASLTIVYGRRYGLVGPNGMGKTTLLKHIGARKLAIPSHI 136

Query: 437 DIFH 448
           D+ +
Sbjct: 137 DLLY 140


>U10414-9|AAA19072.1|  712|Caenorhabditis elegans Hypothetical
           protein F42A10.1 protein.
          Length = 712

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 24/62 (38%), Positives = 38/62 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DIK+ +  I+    +LL    + +  GRRYGLVG NG GK++LL  +  +++ IP  I
Sbjct: 176 SKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGI 235

Query: 437 DI 442
            +
Sbjct: 236 SM 237


>U97407-4|AAB52482.3| 1272|Caenorhabditis elegans P-glycoprotein
            related protein 2 protein.
          Length = 1272

 Score = 35.5 bits (78), Expect = 0.028
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITF---YGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I N    +     +++LQ   L++  G+   LVG +GCGKS+++  L R
Sbjct: 1023 PITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLER 1078



 Score = 33.9 bits (74), Expect = 0.086
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L+   LEL  G +  LVG +GCGKS+++  L+R
Sbjct: 416 VLKGISLELKAGDKIALVGSSGCGKSTIVNLLQR 449


>EF205592-1|ABM92304.1| 1272|Caenorhabditis elegans ABC transporter
            PGP-2 protein.
          Length = 1272

 Score = 35.5 bits (78), Expect = 0.028
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITF---YGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I N    +     +++LQ   L++  G+   LVG +GCGKS+++  L R
Sbjct: 1023 PITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLER 1078



 Score = 33.9 bits (74), Expect = 0.086
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L+   LEL  G +  LVG +GCGKS+++  L+R
Sbjct: 416 VLKGISLELKAGDKIALVGSSGCGKSTIVNLLQR 449


>U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis
           transmembrane conductanceregulator homolog protein 1
           protein.
          Length = 1247

 Score = 35.1 bits (77), Expect = 0.037
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 263 DIKIANFSITFYGSE-LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           DIKI N + ++ G +  L D  + +  G ++  +G   CGKSSLL ++
Sbjct: 406 DIKILNANFSWNGKDDTLNDVCVHVKKGEKHAFIGFPLCGKSSLLFSI 453


>Z77666-6|CAB01232.1| 1321|Caenorhabditis elegans Hypothetical
           protein K08E7.9 protein.
          Length = 1321

 Score = 34.7 bits (76), Expect = 0.049
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)
 Frame = +2

Query: 263 DIKIANFSITFYGSE---LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           DI + N   T+       +L+   L +N G+   LVG +GCGKS++++ L R
Sbjct: 415 DITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLR 466



 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            E+L+     +  G+   LVG +GCGKS+++A L R
Sbjct: 1093 EILKGLSFSVEPGQTLALVGPSGCGKSTVVALLER 1127


>X65054-1|CAA46190.1| 1321|Caenorhabditis elegans P-glycoprotein A
           protein.
          Length = 1321

 Score = 34.7 bits (76), Expect = 0.049
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)
 Frame = +2

Query: 263 DIKIANFSITFYGSE---LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           DI + N   T+       +L+   L +N G+   LVG +GCGKS++++ L R
Sbjct: 415 DITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLR 466



 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            E+L+     +  G+   LVG +GCGKS+++A L R
Sbjct: 1093 EILKGLSFSVEPGQTLALVGPSGCGKSTVVALLER 1127


>U66260-1|AAB07021.1| 1540|Caenorhabditis elegans multidrug resistance
            related protein1 protein.
          Length = 1540

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1296 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1350


>U41554-9|AAP82650.1|  328|Caenorhabditis elegans Multidrug
           resistance protein familyprotein 1, isoform d protein.
          Length = 328

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 84  PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 138


>U41554-8|ABA03118.1| 1534|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 1, isoform e protein.
          Length = 1534

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1290 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1344


>U41554-7|AAM69107.1| 1534|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 1, isoform c protein.
          Length = 1534

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1290 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1344


>U41554-6|AAL06032.1| 1534|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 1, isoform b protein.
          Length = 1534

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1290 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1344


>U41554-5|AAD31550.2| 1528|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 1, isoform a protein.
          Length = 1528

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1284 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1338


>AB199793-1|BAD88409.1| 1534|Caenorhabditis elegans multidrug
            resistance-associatedprotein protein.
          Length = 1534

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I I NFS+ +  G +L L      ++   + G+VG  G GKSSL  AL R
Sbjct: 1290 PENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFR 1344


>Z49126-5|CAA88940.3| 1270|Caenorhabditis elegans Hypothetical
           protein DH11.3 protein.
          Length = 1270

 Score = 31.9 bits (69), Expect = 0.35
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           RD++   F+     +E+LQ   L++  G+   LVG +GCGKS+ +  L +
Sbjct: 403 RDVRFKYFT---RDNEVLQGLSLQVLPGQTVALVGTSGCGKSTSIGLLTK 449



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            L +  G    LVG +GCGKS++++ L R
Sbjct: 1053 LNIPKGHSIALVGASGCGKSTIISMLER 1080


>U28928-7|AAA68339.1|  665|Caenorhabditis elegans Peroxisomal
           membrane protein relatedprotein 1 protein.
          Length = 665

 Score = 31.9 bits (69), Expect = 0.35
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +T  G  L++    E+  GR   + G NGCGKSSL   L
Sbjct: 454 VTPNGDILIESLSFEVPSGRNVLVCGPNGCGKSSLFRTL 492


>Z93782-3|CAB07855.1| 1294|Caenorhabditis elegans Hypothetical
           protein C47A10.1 protein.
          Length = 1294

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+   L+   G+   LVG +GCGKS+++  L+R
Sbjct: 399 KILKGVSLDAQPGQTVALVGSSGCGKSTIIQLLQR 433



 Score = 31.1 bits (67), Expect = 0.61
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   + +  G+   LVG +GCGKS++++ L R   P+
Sbjct: 1047 ILQGLNVHVKPGQTLALVGPSGCGKSTVISLLERLYDPL 1085


>Z81484-12|CAB03973.1| 1294|Caenorhabditis elegans Hypothetical
           protein C47A10.1 protein.
          Length = 1294

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+   L+   G+   LVG +GCGKS+++  L+R
Sbjct: 399 KILKGVSLDAQPGQTVALVGSSGCGKSTIIQLLQR 433



 Score = 31.1 bits (67), Expect = 0.61
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   + +  G+   LVG +GCGKS++++ L R   P+
Sbjct: 1047 ILQGLNVHVKPGQTLALVGPSGCGKSTVISLLERLYDPL 1085


>Z70268-5|CAJ85767.2| 1204|Caenorhabditis elegans Hypothetical protein
            T21E8.1b protein.
          Length = 1204

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +L    L+++ G+   LVG +GCGKS++++ L R
Sbjct: 974  ILNGVNLKVDPGKTLALVGPSGCGKSTIISLLER 1007


>Z70268-4|CAA94220.3| 1263|Caenorhabditis elegans Hypothetical protein
            T21E8.1a protein.
          Length = 1263

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +L    L+++ G+   LVG +GCGKS++++ L R
Sbjct: 1033 ILNGVNLKVDPGKTLALVGPSGCGKSTIISLLER 1066


>Z70268-3|CAA94219.3| 1263|Caenorhabditis elegans Hypothetical protein
            T21E8.2 protein.
          Length = 1263

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +L    L+++ G+   LVG +GCGKS++++ L R
Sbjct: 1033 ILNGVNLKVDPGKTLALVGPSGCGKSTIISLLER 1066


>Z66567-9|CAA91495.1| 1268|Caenorhabditis elegans Hypothetical
           protein ZK455.7 protein.
          Length = 1268

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+    E+N G    LVG +GCGKS+ +  L R
Sbjct: 392 KILKGVSFEVNPGETVALVGHSGCGKSTSIGLLMR 426



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +  N G+   LVG +GCGKS+ +  + R
Sbjct: 1052 MSANFGQTVALVGPSGCGKSTTIQLIER 1079


>Z66562-7|CAA91467.1| 1268|Caenorhabditis elegans Hypothetical
           protein ZK455.7 protein.
          Length = 1268

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+    E+N G    LVG +GCGKS+ +  L R
Sbjct: 392 KILKGVSFEVNPGETVALVGHSGCGKSTSIGLLMR 426



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +  N G+   LVG +GCGKS+ +  + R
Sbjct: 1052 MSANFGQTVALVGPSGCGKSTTIQLIER 1079


>Z66562-6|CAA91463.1| 1266|Caenorhabditis elegans Hypothetical
           protein F42E11.1 protein.
          Length = 1266

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+    E+N G    LVG +GCGKS+ +  L R
Sbjct: 390 KILKGVSFEVNPGETIALVGHSGCGKSTSIGLLMR 424


>X65055-1|CAA46191.1| 1254|Caenorhabditis elegans P-glycoprotein C
           protein.
          Length = 1254

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+    E+N G    LVG +GCGKS+ +  L R
Sbjct: 392 KILKGVSFEVNPGETVALVGHSGCGKSTSIGLLMR 426



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +  N G+   LVG +GCGKS+ +  + R
Sbjct: 1038 MSANFGQTVALVGPSGCGKSTTIQLIER 1065


>AL110487-1|CAB54424.1|  610|Caenorhabditis elegans Hypothetical
           protein Y39E4B.1 protein.
          Length = 610

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +2

Query: 338 CGRRYGLVGLNGCGKSSLLAALRRREVP 421
           CG   GLVG NG GKS+ L  L  ++ P
Sbjct: 113 CGEVLGLVGTNGIGKSTALKILAGKQKP 140


>U66261-1|AAB07022.1| 1525|Caenorhabditis elegans multidrug resistance
            related protein2 protein.
          Length = 1525

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +I I NFS+ +  G +L L      +    + G+VG  G GKSSL  AL R
Sbjct: 1281 PEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFR 1335


>U41554-4|AAA83299.2| 1525|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 2 protein.
          Length = 1525

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +I I NFS+ +  G +L L      +    + G+VG  G GKSSL  AL R
Sbjct: 1281 PEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFR 1335


>Z81049-5|CAE17733.2|  197|Caenorhabditis elegans Hypothetical
           protein C48D1.5 protein.
          Length = 197

 Score = 26.2 bits (55), Expect(2) = 0.67
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 227 LYWVTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRY 352
           LY++     CS DIKI +     Y S   +  L+E+  G  Y
Sbjct: 12  LYYILFIPVCSEDIKIISIENPIYNSRHCE--LIEMRAGHVY 51



 Score = 23.4 bits (48), Expect(2) = 0.67
 Identities = 14/38 (36%), Positives = 16/38 (42%)
 Frame = +2

Query: 440 IFHLTRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAF 553
           I HL   G RYP+R      T   R F  VV G    +
Sbjct: 55  IDHLLEDGCRYPVRQ-----TFLEREFIEVVYGNVTGY 87


>Z70265-1|CAA94202.1| 1283|Caenorhabditis elegans Hypothetical protein
            C05A9.1 protein.
          Length = 1283

 Score = 30.7 bits (66), Expect = 0.80
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +2

Query: 263  DIKIANFSITFYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++K  +F       +++ D + L+L  GR   LVG +G GKS++++ L R
Sbjct: 1037 ELKNVSFEYAQRSDKMILDGVSLKLPAGRTLALVGPSGSGKSTIISLLER 1086


>U41015-1|AAA82317.2| 1396|Caenorhabditis elegans Multidrug
           resistance protein familyprotein 6 protein.
          Length = 1396

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +QD   E   G  YG++G  G GKSSLL  +
Sbjct: 500 VQDLSFEFVAGTCYGIIGSVGSGKSSLLLTI 530


>Z93385-2|CAB07637.1|  358|Caenorhabditis elegans Hypothetical
           protein M01E5.2 protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
           G EL+ D  +E+      GLVG    GKSSLL A+ R +  +  +
Sbjct: 176 GEELIYD--VEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASY 218


>AL032637-11|CAA21622.3| 1119|Caenorhabditis elegans Hypothetical
           protein Y43F8C.12 protein.
          Length = 1119

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L D   ++  G + G+VG  G GKSS   AL R
Sbjct: 892 VLHDISADVAAGEKIGIVGRTGAGKSSFALALFR 925


>Z83319-4|CAB05909.1|  734|Caenorhabditis elegans Hypothetical
           protein T02D1.5 protein.
          Length = 734

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +T  G  ++++  L ++ G    + G NGCGKSSL   L
Sbjct: 476 VTPNGDVVVKNMTLTISPGMHVLITGPNGCGKSSLFRIL 514


>U46673-6|AAC48149.2| 1382|Caenorhabditis elegans P-glycoprotein
           related protein 10 protein.
          Length = 1382

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +E+L+    ++  G +  +VG +G GKS+L A L R
Sbjct: 464 TEVLRGISFKVEAGEKIAIVGSSGSGKSTLTALLLR 499


>U28928-8|AAA68340.1|  661|Caenorhabditis elegans Peroxisomal
           membrane protein relatedprotein 2 protein.
          Length = 661

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +T  G  L++    E+  G    + G NGCGKSSL   L
Sbjct: 450 VTPNGDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVL 488


>Z82078-7|CAB04947.3|  801|Caenorhabditis elegans Hypothetical
           protein W09D6.6 protein.
          Length = 801

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 266 IKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + N +  +  G  ++++   E+  G+   LVG +G GKS+L+  L R
Sbjct: 550 ISVKNLTFEYNTGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFR 598


>AF497514-1|AAM33381.1|  801|Caenorhabditis elegans heavy metal
           tolerance factor 1 protein.
          Length = 801

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 266 IKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + N +  +  G  ++++   E+  G+   LVG +G GKS+L+  L R
Sbjct: 550 ISVKNLTFEYNTGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFR 598


>AF497513-1|AAM33380.1|  801|Caenorhabditis elegans heavy metal
           tolerance factor 1 protein.
          Length = 801

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 266 IKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + N +  +  G  ++++   E+  G+   LVG +G GKS+L+  L R
Sbjct: 550 ISVKNLTFEYNTGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFR 598


>AF490977-1|AAQ06435.1|  801|Caenorhabditis elegans ABC6 protein
           protein.
          Length = 801

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 266 IKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + N +  +  G  ++++   E+  G+   LVG +G GKS+L+  L R
Sbjct: 550 ISVKNLTFEYNTGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFR 598


>Z68113-4|CAA92148.2| 1503|Caenorhabditis elegans Hypothetical protein
            E03G2.2 protein.
          Length = 1503

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    + I ++S   Y  EL   L+   L +  G++ G+ G  G GKSSL  AL R
Sbjct: 1258 PTGGAVNIEDYSCR-YRDELDLVLKQISLNILPGQKVGVCGRTGAGKSSLALALFR 1312


>AF003138-6|ABE73338.1| 1551|Caenorhabditis elegans Abc transporter
            family protein 2 protein.
          Length = 1551

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 341  GRRYGLVGLNGCGKSSLLAALRRREVP 421
            G  +GL+GLNG GK++  A L  +  P
Sbjct: 1233 GECFGLLGLNGAGKTTTFAMLTAKIRP 1259


>AF098999-6|AAC68724.2|  787|Caenorhabditis elegans Half transporter
           (pgp related)protein 4 protein.
          Length = 787

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +L+D    +  G    LVG +G GKSS ++ L    VP
Sbjct: 515 ILKDLSFTVEPGETVALVGPSGSGKSSCISLLENFYVP 552


>AF000264-2|AAC71121.1|  761|Caenorhabditis elegans Half transporter
           (pgp related)protein 2 protein.
          Length = 761

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +L+D  L +  G    LVG +G GKSS+++ +
Sbjct: 531 VLKDLTLSIKSGETVALVGPSGGGKSSIVSLI 562


>Z67882-1|CAA91801.1| 1327|Caenorhabditis elegans Hypothetical
           protein F22E10.3 protein.
          Length = 1327

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +++L    L +  G    LVG +GCGKS+ +  L R   P   ++ I
Sbjct: 444 AKILNGLNLVVEPGTSVALVGHSGCGKSTSVGLLTRLYEPEAGNVTI 490


>Z48783-2|CAC42295.1|  805|Caenorhabditis elegans Hypothetical
           protein F33H1.1b protein.
          Length = 805

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -3

Query: 508 VNCNTTHYRANWVPGPPSSQMEYVNVFRNRNL 413
           V+ NT H +A W+ G  S  + +VN     NL
Sbjct: 644 VDINTVHQQAGWICGCDSVMVHHVNNAFKHNL 675


>Z48783-1|CAA88701.1|  780|Caenorhabditis elegans Hypothetical
           protein F33H1.1a protein.
          Length = 780

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -3

Query: 508 VNCNTTHYRANWVPGPPSSQMEYVNVFRNRNL 413
           V+ NT H +A W+ G  S  + +VN     NL
Sbjct: 619 VDINTVHQQAGWICGCDSVMVHHVNNAFKHNL 650


>AY519858-1|AAR89639.1| 1327|Caenorhabditis elegans P-glycoprotein
           related (146.8 kD)(pgp-14) protein.
          Length = 1327

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +++L    L +  G    LVG +GCGKS+ +  L R   P   ++ I
Sbjct: 444 AKILNGLNLVVEPGTSVALVGHSGCGKSTSVGLLTRLYEPEAGNVTI 490


>AL132902-3|CAC14419.1|  271|Caenorhabditis elegans Hypothetical
           protein Y71A12B.3 protein.
          Length = 271

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = -2

Query: 209 HFRFSF*LKAQCLFCRQLTVFPGYTISSDTIFVFVR 102
           +FR +  ++  C  C+  T+     ++S+T+F+FVR
Sbjct: 98  YFRTNL-IRRNCETCKSRTIISQRHVNSETLFLFVR 132


>AL132902-2|CAB81987.1|  271|Caenorhabditis elegans Hypothetical
           protein Y71A12B.2 protein.
          Length = 271

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = -2

Query: 209 HFRFSF*LKAQCLFCRQLTVFPGYTISSDTIFVFVR 102
           +FR +  ++  C  C+  T+     ++S+T+F+FVR
Sbjct: 98  YFRTNL-IRRNCETCKSRTIISQRHVNSETLFLFVR 132


>AL008867-2|CAE17750.1|  763|Caenorhabditis elegans Hypothetical
           protein C46E1.3 protein.
          Length = 763

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 350 YGLVGLNGCGKSSLLAALR 406
           YG +G  G GKSSL+ A+R
Sbjct: 537 YGFIGGRGVGKSSLIDAMR 555


>AF233652-1|AAF63475.1|  780|Caenorhabditis elegans RFX-type
           transcription factor DAF-19 short variant protein.
          Length = 780

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -3

Query: 508 VNCNTTHYRANWVPGPPSSQMEYVNVFRNRNL 413
           V+ NT H +A W+ G  S  + +VN     NL
Sbjct: 619 VDINTVHQQAGWICGCDSVMVHHVNNAFKHNL 650


>AF226156-1|AAF61564.1|  805|Caenorhabditis elegans RFX-like
           transcription factor DAF-19 protein.
          Length = 805

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -3

Query: 508 VNCNTTHYRANWVPGPPSSQMEYVNVFRNRNL 413
           V+ NT H +A W+ G  S  + +VN     NL
Sbjct: 644 VDINTVHQQAGWICGCDSVMVHHVNNAFKHNL 675


>AF101313-1|AAC69223.1| 1802|Caenorhabditis elegans Abc transporter
            family protein 4 protein.
          Length = 1802

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +2

Query: 272  IANFSITFYGS-ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
            ++N  + +YG+   ++     +N    +GL+G+NG GK+S    L
Sbjct: 1451 VSNNLVKWYGNFNAVKGVNFHVNSKDCFGLLGVNGAGKTSTFQML 1495


>AF078790-4|AAC26932.1|  311|Caenorhabditis elegans Hypothetical
           protein F36H12.8 protein.
          Length = 311

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = -3

Query: 532 HNVCKTTAVNCNTTHYRANWVPGPPSSQM 446
           + + K T  NC    Y  +W PG P + M
Sbjct: 281 YRLMKQTLANCGKPEYPYDWEPGMPLNYM 309


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,950,625
Number of Sequences: 27780
Number of extensions: 257985
Number of successful extensions: 802
Number of sequences better than 10.0: 58
Number of HSP's better than 10.0 without gapping: 724
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 802
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1237082886
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).