SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0010
         (539 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78418-4|CAB01698.1|  710|Caenorhabditis elegans Hypothetical pr...    27   6.5  
U97008-16|AAB52300.1|  303|Caenorhabditis elegans Serpentine rec...    27   6.5  

>Z78418-4|CAB01698.1|  710|Caenorhabditis elegans Hypothetical
           protein F25D7.5 protein.
          Length = 710

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 169 ENILSQLLNYIFQSNQILSLMSCACCVKSYVFILTGRLYL 288
           ++  ++  NYIF S  I SL+SC+  V        G++YL
Sbjct: 191 DSFFTRFGNYIFDSPTINSLVSCSSTVLLIGVKSVGKIYL 230


>U97008-16|AAB52300.1|  303|Caenorhabditis elegans Serpentine
           receptor, class sx protein24 protein.
          Length = 303

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 12/47 (25%), Positives = 23/47 (48%)
 Frame = -3

Query: 150 FKIYYILCS*NLTFTYLVN*HVFSTNVCLRVNFYGMIFIFLNKLLQI 10
           F   Y + +  L    L+N  V S++ C  ++ YG+  + +  LL +
Sbjct: 52  FNFVYCIYAAQLRVMILINESVMSSSTCFLISIYGIFAMNMQSLLAL 98


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,991,708
Number of Sequences: 27780
Number of extensions: 209087
Number of successful extensions: 336
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 334
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 336
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1081316076
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).