SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z93379-7|CAD54132.1|  188|Caenorhabditis elegans Hypothetical pr...    29   3.1  
U47144-5|AAB52621.2| 1410|Caenorhabditis elegans Hypothetical pr...    29   3.1  
AY519853-1|AAR89634.1|  545|Caenorhabditis elegans acetylcholine...    28   5.3  
AL033514-4|CAA22094.2|  827|Caenorhabditis elegans Hypothetical ...    28   5.3  
AL032630-1|CAA21558.1|  366|Caenorhabditis elegans Hypothetical ...    28   5.3  
AF067943-10|AAC17666.3|  545|Caenorhabditis elegans Acetylcholin...    28   5.3  
Z82276-4|CAB05241.3|  327|Caenorhabditis elegans Hypothetical pr...    27   7.0  
AF026209-5|AAB71279.2|  344|Caenorhabditis elegans Serpentine re...    27   9.3  

>Z93379-7|CAD54132.1|  188|Caenorhabditis elegans Hypothetical
           protein F21H7.12 protein.
          Length = 188

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 3/33 (9%)
 Frame = -1

Query: 132 KVFHS-YCCNFIKKTCIFYF--VSCFIYIFSVV 43
           ++ HS Y C+ I    +F F  V+C +Y+FS+V
Sbjct: 130 RLIHSDYQCSIIVPISVFVFSIVTCIVYLFSIV 162


>U47144-5|AAB52621.2| 1410|Caenorhabditis elegans Hypothetical protein
            ZC53.4 protein.
          Length = 1410

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +1

Query: 244  RYIIKYNKI*YTHFTLYMNYNNSYGYINC 330
            +Y   +N+   T+F LY++ NN YG+  C
Sbjct: 1191 KYTKNFNEKQLTNFLLYLDANNLYGWAMC 1219


>AY519853-1|AAR89634.1|  545|Caenorhabditis elegans acetylcholine
           receptor (62.5 kD)(acr-23) protein.
          Length = 545

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 117 YCCNFIKKTCIFYFVSCFIYIFSVV*FTSVCNYSN 13
           Y  N I  T +  F+S   +  SV  FT+ CN S+
Sbjct: 245 YVLNLIAPTAVITFISIIGFFTSVNPFTNFCNVSS 279


>AL033514-4|CAA22094.2|  827|Caenorhabditis elegans Hypothetical
           protein Y75B8A.3 protein.
          Length = 827

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 274 YTHFTLYMNYNNSYGY 321
           YT+ T Y N NN+YGY
Sbjct: 584 YTNVTQYSNVNNNYGY 599


>AL032630-1|CAA21558.1|  366|Caenorhabditis elegans Hypothetical
           protein Y62H9A.1 protein.
          Length = 366

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +1

Query: 49  RKNIYKTRHKIKYACFFYEIATITMKD 129
           R N+YKT ++IKY    Y IA + + D
Sbjct: 175 RDNLYKTDNRIKYFFNEYSIAIVRVSD 201


>AF067943-10|AAC17666.3|  545|Caenorhabditis elegans Acetylcholine
           receptor protein 23 protein.
          Length = 545

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 117 YCCNFIKKTCIFYFVSCFIYIFSVV*FTSVCNYSN 13
           Y  N I  T +  F+S   +  SV  FT+ CN S+
Sbjct: 245 YVLNLIAPTAVITFISIIGFFTSVNPFTNFCNVSS 279


>Z82276-4|CAB05241.3|  327|Caenorhabditis elegans Hypothetical
           protein K03D3.4 protein.
          Length = 327

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -3

Query: 313 NCYYSSYKA*NV-YIIFCYILLCTGTSGLTIFGRLIV 206
           N +Y    A N+ Y++F   +LCT   GL I+  LI+
Sbjct: 64  NHFYKCVVAMNIGYVLFGIFVLCTLAEGLLIYISLII 100


>AF026209-5|AAB71279.2|  344|Caenorhabditis elegans Serpentine
           receptor, class j protein25 protein.
          Length = 344

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = -1

Query: 180 LSRFPTFNPFHLYFILKVFHSYCCNFIK 97
           +S FP F+P  + F +  F + C NF K
Sbjct: 288 VSTFPFFDPTAIIFFIPSFRAKCINFGK 315


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,895,095
Number of Sequences: 27780
Number of extensions: 272246
Number of successful extensions: 718
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 679
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 718
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1166125180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).